Conserved Protein Domain Family
SufR_cyano

?
TIGR02702: SufR_cyano 
iron-sulfur cluster biosynthesis transcriptional regulator SufR
All members of this cyanobacterial protein family are the transcriptional regulator SufR and regulate the SUF system, which makes possible iron-sulfur cluster biosynthesis despite exposure to oxygen. In all cases, the sufR gene is encoded near SUF system genes but in the opposite direction. This DNA-binding protein belongs to the the DeoR family of helix-loop-helix proteins. All members also have a probable metal-binding motif C-X(12)-C-X(13)-C-X(14)-C near the C-terminus. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131749
View PSSM: TIGR02702
Aligned: 4 rows
Threshold Bit Score: 336.031
Threshold Setting Gi: 22294212
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB74190   8 STKQEILEYLLKHSQATALDLANVLDVSPQAIRRHLKDLETEELVVYSNTMQAgMGRPQHVYQLSRQGRERLHKnv---- 83  Nostoc sp. PCC 7120
BAA10541  32 STKEDILCYLLKEGQGSAIAMAEELGISPQAMRKHLKDLENDGLIEHQQERQS-MGRPQFLYQLSKQGREQFPQ------ 104 Synechocystis sp. P...
BAD80548   8 TTKEAILSLLLEQGQATSAAIAEALAISLQAVRRHLKDLATEGLIEQEAVVAG-LGRPQYHFRLSRQGRSQFPS------ 80  Synechococcus elong...
BAC08043   6 DTKQDILHCLLRDGHLSAQELAAQLAISPQAVRRHLKDLEAEQLVTYK-VLSGtVGRPQYRYTISEAGREELRQlqlrqq 84  Thermosynechococcus...
BAB74190  84 sdRHGDFAVSLLDTLAETVGHDQFKTILQKQWERKAQEYRDRVGKGSLQERVANLVELRKNEGFMAEYHPVDsseSTQKE 163 Nostoc sp. PCC 7120
BAA10541 105 --RYGEFALSFIDSLVETVGEEQLGAVLKKQWQRKAEAYRQQIGQGPLSKRVHKLVELRRQEGYMAEIHPLS---VEQAE 179 Synechocystis sp. P...
BAD80548  81 --SHDRFAVDLLDSLSEMLPPQEFEAVLAHQWRRKAETYRRQLGQGSLADRLQQLAALRQAEGFMAEVHPAP---DRSPP 155 Synechococcus elong...
BAC08043  85 atHPKGFALELLESVAATLGPEQMQDVLQAAWQRKALAYREQMGSGTLAERLARLVALRQQEGYMAEFYPVS----EPKG 160 Thermosynechococcus...
BAB74190 164 RFIFIEHNCAISNVAESFPSVCGHELEMFAAVLPDCTVERTHWLINGEHRCGYLV 218 Nostoc sp. PCC 7120
BAA10541 180 KFILSEHHCAIADVAESYPTVCGHELEMFAAILPDCAIERTHWLNDGEHTCGYLI 234 Synechocystis sp. PCC 6803
BAD80548 156 AFVITEYNCAIASVAESFPRVCDHELALFAETLPDCHVERTHWLIDGEHRCGYLI 210 Synechococcus elongatus PCC 6301
BAC08043 161 AYLLTEYNCAISAVAQSFPTVCHHELEMFAIALGDCAVERTHWLVDGEHRCGYLI 215 Thermosynechococcus elongatus BP-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap