Conserved Protein Domain Family
flavo_MJ0208

?
TIGR02700: flavo_MJ0208 
archaeoflavoprotein, MJ0208 family
This model describes one of two paralogous families of archaealflavoprotein. The other, described by TIGR02699 and typified by the partially characterized AF1518 of Archaeoglobus fulgidus, is a homodimeric FMN-containing flavoprotein that accepts electrons from ferredoxin and can transfer them to various oxidoreductases. The function of this protein family is unknown. [Unknown function, General]
Statistics
?
PSSM-Id: 131747
View PSSM: TIGR02700
Aligned: 3 rows
Threshold Bit Score: 403.099
Threshold Setting Gi: 2494448
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q57661    10 KIVWCITGAGHLLRESFQVMKRLKEEIEDLKVTTLVSRAGEEVVKMYGLFGELYNISNGNYYEELILEREHPYSSPITGR 89  Methanocaldococcus ...
AAM31550   5 RIAWGITGAGHFLDRSYQVFKELKLRNPELSVNTYVSRAAEEVLRMYGLEQKLVKISGGDYLEEIFRESEQGSSSPKVGR 84  Methanosarcina maze...
AAM02697   4 RIGWGITGAAHLLVETFKIMKEISR---EHRISAFLSEAGEEVVRMFGLWDDLREICPGGFYREVFTQSEEGASCPIIGR 80  Methanopyrus kandle...
Q57661    90 LSLGKYDYLICSPATGNTVAKVVNGIADSLVTNAIAQAGKGFVKSLIVPVDYKAGIVTtKLPYAIDKKKCKLCLKCIN-- 167 Methanocaldococcus ...
AAM31550  85 FALDRYDALFVTPATSNTVSKIAYGIADSLVTNAVSQAVKGRVPVFVVPVDIEGSIIS-EMPYNIDRKQCKHCETCPPre 163 Methanosarcina maze...
AAM02697  81 FALGKYDLLIVSPATANTVAKIAHGIADTLVTNAVAQAGKGDVPVWVVPCDYEEGKIRtITPYMVLRERCEGCGICVD-- 158 Methanopyrus kandle...
Q57661   168 VCPNGAIVKRDNFV-EILLSKCLGCGNCKKVCPYNAIIEGkEIKMRVRKIDAENTRKLMELEDVIVLKHPYEILEFF 243 Methanocaldococcus jan...
AAM31550 164 NCPHEAISEKNGVTdQIDLLKCKGCGICKELCPYNAIKGG-PVEVLVRDVDMRNVEIVKSLQGITVLESPEAILELF 239 Methanosarcina mazei Go1
AAM02697 159 ACPRSAIDMVDGKA-FIRLLRCVGCGKCAEACPEDAIHGGlEYEMRVRSVDAENVRKLERIEGIEVLRHPEEIPERL 234 Methanopyrus kandleri ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap