Conserved Protein Domain Family
archaeo_AfpA

?
TIGR02699: archaeo_AfpA 
archaeoflavoprotein AfpA
The prototypical member of this archaeal protein family is AF1518 from Archaeoglobus fulgidus. This homodimer with two non-covalently bound FMN cofactors can receive electrons from ferredoxin, but not from a number of other electron donors such as NADH or rubredoxin. It can then donate electrons to various reductases. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131746
View PSSM: TIGR02699
Aligned: 4 rows
Threshold Bit Score: 302.117
Threshold Setting Gi: 2621783
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB85202   6 SVAWCITGAGEKLTETYAIMKDVKKIYGDrvKIDVFISKAGDQVVKYYGLYRDLETSFDRKWVEINANSPFLAGQVQLGK 85  Methanothermobacter...
AAB89728  11 RVAWGITGSGDRLPETVDVMLEVKKEFPDv-EIAVYLSKAGAQVVKYYKLMDTLKENFGAVRVEIDANTPFLAGQIQVGR 89  Archaeoglobus fulgi...
Q58140     3 KIAWGITGCGDKLPEVVEIMKKLKNKYNL--DVDIYLSKNAKIVVKWYKLWQVLEDEFYDLRVEVNANAPFLVGKLQTGK 80  Methanocaldococcus ...
AAM30331  11 RIAWGITGSGDQMIETYSILVDIKNRTGV--ETMVFLSKEGETVMKWYHLWDKIQNDFPNFKVDAGPNSPFIAGPLQMGY 88  Methanosarcina maze...
AAB85202  86 YDFILVAPCTSNSTAKISLRIGDTLVTNAVIMAQKASVPVYIMPSDYSEGKVVTTLPNGKKLELRITKEDVEHVKKISKM 165 Methanothermobacter...
AAB89728  90 YEFLLIAPATSNTVAKIAMGIADSLLANAAIMGLKAYVPLYIMPSDYKEGEVITKLPDGRDLRLRVRKEDVEHVRKLAQM 169 Archaeoglobus fulgi...
Q58140    81 YDLFLVAPATANTTAKIAYGIADTLITNSVAQAMKAKVPVYIFPPDNKKGTVETILPGNKKLTLYMRDVDVENVERLRRM 160 Methanocaldococcus ...
AAM30331  89 YDFLLIAPATANTVAKIVYGIADTLVTNAVSQTAKGKTPIFILPVDQKRGTVKTAAPSGRAFELTMREVDVTNSEKLAQM 168 Methanosarcina maze...
AAB85202 166 DRTEVFSDPQKIYKIF 181 Methanothermobacter thermautotrophicus str. Delta H
AAB89728 170 DGVTILEKPEDIPKVF 185 Archaeoglobus fulgidus DSM 4304
Q58140   161 EGIEVLDKPEDIEKVI 176 Methanocaldococcus jannaschii DSM 2661
AAM30331 169 ENINILTSPYEIYDIF 184 Methanosarcina mazei Go1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap