Conserved Protein Domain Family
CopY_TcrY

?
TIGR02698: CopY_TcrY 
copper transport repressor, CopY/TcrY family
This family includes metal-fist type transcriptional repressors of copper transport systems such as copYZAB of Enterococcus hirae and tcrYAZB (transferble copper resistance) of an Enterocuccus faecium plasmid. High levels of copper can displace zinc and prevent binding by the repressor, activating efflux by copper resistance transporters. The most closely related proteins excluded by this model are antibiotic resistance regulators including the methicillin resistance regulatory protein MecI. [Transport and binding proteins, Cations and iron carrying compounds, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131745
View PSSM: TIGR02698
Aligned: 7 rows
Threshold Bit Score: 191.093
Threshold Setting Gi: 14972202
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O07127         7 EITTSEWEVMRIVWSLGQVNSRDLIDLLQPKRDWQDSTIKTLIGRLVKKGFLKTEKEGRRFNYTATVPEIEAMENATQSL 86  Lactobacillus s...
AAS09780       8 SISDSEWEVMRIVWTLGETNTKQILNELQAKKDWTDSTIKTLIRRLVQKGWLNAKQDGRRYIYTATVNQTEMMYNEAKTL 87  Lactobacillus j...
Q47839         9 KISDSEWEVMRVIWTLGQANAQQITQILADSMDWKVATVKTLLGRLVKKEALWTEQEGKKFIYHPAVSEMENVRSATENL 88  Enterococcus hi...
AAN58178       3 SISNAEWEVMRVVWAKQMTSSSEIIAILSRTYCWSASTIKTLITRLSEKGYLTSQRQGRKYIYSSLISEEEALEQQVSEV 82  Streptococcus m...
AAN00137       9 SITDAEWEVMRVVWANDLVTSKTVISVLKEKMDWTESTIKTILGRLVEKGVLNTEQEGRKFIYTANIVEKEAVRDFAEDI 88  Streptococcus a...
AAO80160       8 TITDAEWEVMRVIWTQGKTTSREVHTLLNEKKEWKSTTVKTLLSRLTDKGLVGTEKAGNKYIYYPLVEERQSVETVADEL 87  Enterococcus fa...
tigr:SP_0727   4 QISDAEWQVMKIIWMQGEQTSTDLIRVLAERFDWSKSTVQTLLARLVDKECLTRKKEGKSFVYSALLTLDQSRDLLVQDI 83  Streptococcus p...
O07127        87 FEHLCGMKKGQTLAALIDQTTLSQTDILQLQQLLTAKAATAPEKVACDCL 136 Lactobacillus sakei
AAS09780      88 LNRMCDMHKGEVILKLLEDSPVSKGDLMKMKKEISQKEKTALEMVPCNCL 137 Lactobacillus johnsonii NCC 533
Q47839        89 FSHICAKRVGATIADLVEEATLTQEDIQQIMKQLNKKE--PVETIECNCI 136 Enterococcus hirae ATCC 9790
AAN58178      83 FSRICVTKHQALIRHLIEETPMTLSDIEKLEALLLSKKANAVPEVKCNCI 132 Streptococcus mutans UA159
AAN00137      89 FNRICKKKVGNVIGSIIEDHVLSFDDIDRLEKILEIKKSFAVEEVDCQCT 138 Streptococcus agalactiae 2603V/R
AAO80160      88 LAKVCSRKVGSVVETILTESQLSYDDLDRLEELLKEKRKTAVESVPCNCI 137 Enterococcus faecalis V583
tigr:SP_0727  84 KDKVCSRRIRNLLADLIVECEFTQTDLEDLEAVISEKKSSAVTEVRCNCM 133 Streptococcus pneumoniae TIGR4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap