1E3P


Conserved Protein Domain Family
pppGpp_PNP

?
TIGR02696: pppGpp_PNP 
Click on image for an interactive view with Cn3D
guanosine pentaphosphate synthetase I/polynucleotide phosphorylase
Sohlberg, et al. present characterization of two proteins from Streptomyces coelicolor. The protein in this family was shown to have poly(A) polymerase activity and may be responsible for polyadenylating RNA in this species. Reference 2 showed that a nearly identical plasmid-encoded protein from Streptomyces antibioticus is a bifunctional enzyme that acts also as a guanosine pentaphosphate synthetase.
Statistics
?
PSSM-Id: 131743
View PSSM: TIGR02696
Aligned: 8 rows
Threshold Bit Score: 1338.3
Threshold Setting Gi: 38200310
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1E3P_A        21 ETHYAEAVIDNGAFGTRTIRFETGRLARQAAGSAVAYLDDDTMVLSATTASKNPKDQLDFFPLTVDVEERMYAAGKIPGS 100 Streptomyces an...
CAD55364       4 ETHYAEAVIDNGAFGTRTIRFETGRLARQAAGSAVAYLDDDTMVLSATSASKNPKDQLDFFPLTVDVEERMYAAGKIPGS 83  Streptomyces co...
jgi:Tfu_0784   3 GVYSAEAVIDNGRFGTRTIRFETGRLARQATGSATAYLDDETMVLSATTVSKRPKEALDFFPLTVDVEERMYAAGRIPGS 82  Thermobifida fu...
BAD58735      17 GVFESVALIDNGSYGTRTVRFETGRLARQAAGSVVAYLDDETMLLSATTAGKTPKDQFDFFPLTVDVEERMYAAGRIPGS 96  Nocardia farcin...
AAT83219       5 GLEFTEAIIDNGKLGKHVVRFEAGLLAQQADGSAAVYLDGDTMLLSATTAAKTPRDSIDFFPLTVDVEERMYAAGRIPGS 84  Propionibacteri...
CAE49995      17 GITEAIATIDNGDFGKRTIRFETGQLARQADGSVTTYLDDDTMLLATTTASNQPREGFDFFPLTVDVEERMYAAGRIPGS 96  Corynebacterium...
AAO44518       3 DVQFSEGVIDNGRFGTRTIRFETGRLARQAQGSVVAYLDGETMLLSSTSVGKQPKEDCDFFPLTVDVEERSYAAGKIPGS 82  Tropheryma whip...
AAT88793       5 EITFAEAMLDNGRFGARTVRFETGRIAQQAQGAVAAYLDEETMLLSATSASKHPKDNFDFFPLTVDVEERSYAAGKIPGS 84  Leifsonia xyli ...
1E3P_A       101 FFRREGRPSEDAILTCRLIDRPLRPSFKKGLRNEIQVVATIMALNPDHLYDVVAINAASASTQLAGLPFSGPIGGVRVAL 180 Streptomyces an...
CAD55364      84 FFRREGRPSEDAILTCRLIDRPLRPSFKKGLRNEIQVVATIMALNPDHLYDVVAINAASASTQLAGLPFSGPIGGVRVAL 163 Streptomyces co...
jgi:Tfu_0784  83 FFRREGRPSEDAILTCRLIDRPLRPSFQKGLRNEIQIVATVLALHPDHLYDVIAINAASMSTQLAGLPFSGPIGGVRVAL 162 Thermobifida fu...
BAD58735      97 FFRREGRPSTDAILTCRLIDRPLRPSFVDGLRNEVQVVVTVLSLDPKDLYDVVAINAASASTQIAGLPFSGPVGGVRVAL 176 Nocardia farcin...
AAT83219      85 FFRREGRPSEGAILACRLIDRPLRPSFVKGLRNEVQVVVTVMALNPAVYYDVVAINAASMSTQLAGLPFSGPIGGVRMAL 164 Propionibacteri...
CAE49995      97 FFRREGRPSTEAILACRLIDRPLRPTFVKGLRNEVQVVITVLSVNPQDMYDVVAINGASAATQLSGLPVSGPVGGVRMAL 176 Corynebacterium...
AAO44518      83 YFRREGRPSTEAILACRLIDRPLRPSFNAGLRNEVQVIVTVLSIAPGEFYEALAINAASASTLVSGLPFSGPIGGVRLAL 162 Tropheryma whip...
AAT88793      85 FFRREGRPSTEAILVCRLIDRPLRPSFVDGLRNEVQIVVTVLSIAPDEFYDALAINAASASTQISGLPFSGPIAGVRLAL 164 Leifsonia xyli ...
1E3P_A       181 IR---------GQWVAFPTHTELEDAVFDMVVAGRVLED-------GDVAIMMVEAEATEKTIQLVKD-GAEAPTEEVVA 243 Streptomyces an...
CAD55364     164 IR---------GQWVAFPTHTELEDAVFDMVVAGRVLED-------GDVAIMMVEAEATDKTIKLVEG-GAEAPTEEVVA 226 Streptomyces co...
jgi:Tfu_0784 163 VE---------GQWVAFPTHSELANATFDMVVAGRVLDN-------GDVAIMMVEAESTPHTLRLVAE-GAIGPNEQTVA 225 Thermobifida fu...
BAD58735     177 IPdqgansaggGQWVAFPTVEQLEGAVFDMVVAGRVVES-------GDVAIMMVEAEATEKVIELVEG-GAQAPTEAVVA 248 Nocardia farcin...
AAT83219     165 ID---------DQWVCFPSVDQRKESTFDMVVAGRVLAD-------GDVAIMMVEAESTPATWGLVRG-GRTAPTEEVVA 227 Propionibacteri...
CAE49995     177 IAdda---hpkGQWIAFPTHEQHEQALFELVVAGRIVSKkqgkktvDDVAIMMVEAGATEQVVDRVKA-GAPAPTESVVA 252 Corynebacterium...
AAO44518     163 IDg---------QWVAFPRYEDLSGAVFDLTVAGRVFVNesg---keDIAIMMVEAEATESAWDLIHShGAKKPNEEVIE 230 Tropheryma whip...
AAT88793     165 IPgng---aheDQWVAFPKASQLEEAVFDLIVVGRVLTNedg--teGDVAIMMVEAEATEGSWNLIQG-GAVKPNEEVVA 238 Leifsonia xyli ...
1E3P_A       244 AGLDAAKPFIKVLCKAQADLAAKAAKPTGEFPVFLDYQDDVLEALSAAVRPELSAALTIAGKQDRE----AELDRVKALA 319 Streptomyces an...
CAD55364     227 AGLDAAKPFIKVLCRAQADLAAKAAKPTGEFPIFLDFQDDVLEALTGAVKPELTQALTIAGKQERE----AELDRVKGLA 302 Streptomyces co...
jgi:Tfu_0784 226 EGLEAAKPFIKVLCRAQQTVAEAAGKPPGEYPIFIDYQDDAYAAVEEAIHDELAAALTIADKQERE----AELDRVKALV 301 Thermobifida fu...
BAD58735     249 EGLEAAKPFIARLCRAQQDLAELAAKPTEEFPLFPPYGPDVYEAVEGAAEAELGEALSIAGKQERE----EKIDEIKLAV 324 Nocardia farcin...
AAT83219     228 TGLEAAKPFIKVLCDAQVALAAKLPKETYDFPVFKDYEDDVYAAVEEKAADELSRIEQIAAKLERQ----EAESELKARI 303 Propionibacteri...
CAE49995     253 EGLEAAKPFIEVLCRAQAGLAERAAKETQEFPLFPPYTDVVYDAVEKKVSKKLRSLLTIKSKQDRD----EATNAYMEEI 328 Corynebacterium...
AAO44518     231 EGIESAKVFIRTLCDIQRDLASKLSLSHTEPDLYPDYSDSVHSFVEGLVKSDLEKVYRGNHDSGYApnalSASDEIKQKA 310 Tropheryma whip...
AAT88793     239 QGLEAAKPFIRQLVGAQAALAKQSAKAIADYPVFLPYSQETYDSVAALAYDELVNVYQIADKVERQ----NADDALKERV 314 Leifsonia xyli ...
1E3P_A       320 AEKLLPEFE------GREKEISAAYRALTKSLVRERVIAEKKRIDGRGVTDIRTLAAEVEAIPRVHGSALFERGETQILG 393 Streptomyces an...
CAD55364     303 AEKLLPEFE------GREKEISAAYRALTKSLVRERVIKEKKRIDGRGVTDIRTLAAEVEAIPRVHGSALFERGETQILG 376 Streptomyces co...
jgi:Tfu_0784 302 AEKLAEDFE------GREKELAAAFRALTRKLVRERIVKDGVRIDGRGVKDIRSLTAEVNVIPRVHGSALFERGETQILG 375 Thermobifida fu...
BAD58735     325 LDRLAEQFA------GREKELGAAFRSVTKKLVRQRILTDGFRIDGRGLADIRALSAEVAVVPRAHGSALFERGETQILG 398 Nocardia farcin...
AAT83219     304 KAELAETFP------EREAEISGAFKAVMKKIVRKRVLDEGVRIDGRGPRDIRSLSAEVGIIPRVHGSALFQRGETQILG 377 Propionibacteri...
CAE49995     329 EADLIAQLGsdd-eaAASKAIRAAYNAVMKKIVRHMILTEHFRIDGRGVTDIRDLGVEVDLIPRAHGSSLFERGETQILG 407 Corynebacterium...
AAO44518     311 YDAFHDAVLsgrfdqDSLSQFPHAYKAVLKDVVRTCVLEGFARMDGRGLSDIRPLDAEVQVVPRVHGSAVFQRGETQVLG 390 Tropheryma whip...
AAT88793     315 KAALAEKAQagaldaEALTQFSAAYKSVSKVVMRGRVLREGVRIDGRGLTDIRPLDAEVQIIPRVHGSAVFQRGETQILG 394 Leifsonia xyli ...
1E3P_A       394 VTTLNMLRMEQQLDTLSPVTRKRYMHNYNFPPYSVGETGRVGSPKRREIGHGALAERAIVPVLPTREEFPYAIRQVSEAL 473 Streptomyces an...
CAD55364     377 VTTLNMLRMEQQLDTLSPVTRKRYMHNYNFPPYSVGETGRVGSPKRREIGHGALAERAIVPVLPTREEFPYAIRQVSEAL 456 Streptomyces co...
jgi:Tfu_0784 376 ITTLNMLRMEQTIDTLNPERTKRYMHNYNFPPYSTGETGRVGAPKRREIGHGALAERALVPVLPSREEFPYAIRQVSEAI 455 Thermobifida fu...
BAD58735     399 VTTLDMVKMAQQVDSLGPETSKRYMHHYNFPPFSTGETGRVGSPKRREIGHGALAERALIPVLPSQEDFPYAIRQVSEAL 478 Nocardia farcin...
AAT83219     378 VSTLNMLDMEQKLDTLSPENTRRYMHNYNMPPYSTGETGRVGSPKRREIGHGNLAERALIPVLPTREEFPYAIREVSEAI 457 Propionibacteri...
CAE49995     408 VTTLDMLKMEQQIDSLTPATSKRYIHHYNFPPYSTGETGRVGSPKRREIGHGALAERALVPVIPSREEFPYAIRQVSEAL 487 Corynebacterium...
AAO44518     391 VTTLNMLKMEQQIDSLAPIVSKRYIHHYNFPPYSTGEVGRVGSPKRREIGHGFLAERALVPVLPSREDFPYAIRQVSEAL 470 Tropheryma whip...
AAT88793     395 VTTLNMLKMEQQIDSLSPVTKKRYLHHYNFPPYSTGETGRVGSPKRREIGHGFLAERALVPVLPSREEFPYAIRQVSEAL 474 Leifsonia xyli ...
1E3P_A       474 GSNGSTSMGSVCASTMSLLNAGVPLKAPVAGIAMGLISQ-EING-----ETHYVALTDILGAEDAFGDMDFKVAGTKEFV 547 Streptomyces an...
CAD55364     457 GSNGSTSMGSVCASTMSLLNAGVPLKAPVAGIAMGLISQ-EING-----ETHYVALTDILGAEDAFGDMDFKVAGTKEFV 530 Streptomyces co...
jgi:Tfu_0784 456 GSNGSTSMGSVCASTMSLMAAGVPLKDMVAGIAMGLIYE-DGK---------YVTLTDILGAEDAYGDMDFKVAGTRDLI 525 Thermobifida fu...
BAD58735     479 GSNGSTSMGSVCASTLSLLNAGVPLKAPVAGIAMGLVSD-TVTNdkgeqEVRYVALTDILGAEDAFGDMDFKVAGTREFV 557 Nocardia farcin...
AAT83219     458 GSNGSTSMGSVCASTLALLNAGVPLRASVAGIAMGLMSEtDEDG-----KTKYLALTDILGAEDALGDMDFKVAGTSEFV 532 Propionibacteri...
CAE49995     488 GSNGSTSMGSVCASTLSLYNAGVPLKAPVAGIAMGLVSD-EVDG-----ETRYVALTDILGAEDAFGDMDFKVAGTRQFI 561 Corynebacterium...
AAO44518     471 GSNGSTSMGSVCASTLSLLNAGVPLRAPVAGIAMGLISG-RVDG-----EMRYVTLTDISGSEDALGDMDFKVAGTSDFI 544 Tropheryma whip...
AAT88793     475 SSNGSTSMGSVCASTLSLLNAGVPLRAPVAGIAMGLISD-VIDG-----ETRYAALTDILGAEDALGDMDFKVAGTSEFV 548 Leifsonia xyli ...
1E3P_A       548 TALQLDTKLDGIPASVLAAALKQARDARLHILDVMMEAIDTPDEMSPNAPRIITVKIPVDKIGEVIGPKRQMINQIQEDT 627 Streptomyces an...
CAD55364     531 TALQLDTKLDGIPASVLAAALKQARDARLHILDVMMEAIDTPDEMSPNAPRIITVKIPVDKIGEVIGPKGKMINQIQEDT 610 Streptomyces co...
jgi:Tfu_0784 526 TALQLDTKLDGIPAEVLASALQQARGARLAILDVMSEAINRPAEISPHAPRILTVKVPIDKIGEVIGPKGKMINSIQDET 605 Thermobifida fu...
BAD58735     558 TALQLDTKLDGIPSQVLAGALSQAHDARTTILDVMAEAIATPDEMSPYAPRVTAIKIPVDKIGEVIGPKGKVINQITEDT 637 Nocardia farcin...
AAT83219     533 TALQLDTKLDGIPADVLAGALKQAKEARTAILEVMNEAIDSPDEMAPTAPRIITVHIPVDKIGEVIGPKGKMINQIQDDT 612 Propionibacteri...
CAE49995     562 TALQLDTKLDGIPSEVLAQALSQANDARNTILDTMAEVIETPDEMSDYAPRITAITVPVNKIGEVIGPKGKTINSITEET 641 Corynebacterium...
AAO44518     545 TALQLDTKLDGIPAHVLSEALAHARSARLAILDVLTRVIDSPDQMSEYAPRVVRVKIPVQKIGELIGPKGKVINSIQDET 624 Tropheryma whip...
AAT88793     549 TAIQLDTKLDGIPSSVLASALKQAKDARTTILSVLDAAIDAPDEMAPTAPRVISVQIPVDKIGELIGPKGKTINAIQDET 628 Leifsonia xyli ...
1E3P_A       628 GAEITIEDDGTIYIGAADGPAAEAARATINGIANPTSPEVGERILGSVVKTTTFGAFVSLLPGKDGLLHISQIRKLAGGK 707 Streptomyces an...
CAD55364     611 GADITIEDDGTIYIGAAQGSQAEAARATINGIANPTMPEVGERYLGTVVKTTTFGAFVSLLPGKDGLLHISQIRKLAGGK 690 Streptomyces co...
jgi:Tfu_0784 606 GAEITIEDDGTIYIGATDGPSAEAARDAINSIANPTMPEVGERYLGTVVKTTAFGAFVSLLPGKDGLLHISQIRKMHGGQ 685 Thermobifida fu...
BAD58735     638 GANISIEDDGTVFVGATDGPSAQAAIDAINAIANPQLPKVGERFLGTVVKTTAFGAFVSLLPGRDGLVHIS---KLGNGK 714 Nocardia farcin...
AAT83219     613 GANISIEDDGTIFIGADNGDSAESARSMINAIANPQMPEVGERYLGTVVKTTSFGAFVSLLPGKDGLLHISKMRDLNDGK 692 Propionibacteri...
CAE49995     642 GANISIEEDGTVYVSAASGAAAEAAIEKINAIANPQLPKVGERFLGTVVKTTAFGAFVSLLPGRDGLVHIS---KLGGGK 718 Corynebacterium...
AAO44518     625 GAEISIEDDGTVYIGSSQADSSEKAVAMVNSIVNPVEPCVGSQFLGTVVKNMPFGSFISLVPGKDGLLHISEIRKMVDGR 704 Tropheryma whip...
AAT88793     629 GADISIDEDGTVYIGAVDGPSAEAARAQVNVIANPTNPEVGEQFLGTVVKNAAFGAFVSLLPGKDGLLHISEVRKLAGGK 708 Leifsonia xyli ...
1E3P_A       708 RVENVEDVLGVGQKVQVEIAEIDSRGKLSLIP 739 Streptomyces antibioticus
CAD55364     691 RVENVEDVLGVGAKVQVEIAEIDSRGKLSLIP 722 Streptomyces coelicolor A3(2)
jgi:Tfu_0784 686 RIENVEDVISIGEKIHVEVRDIDERGKLSLVP 717 Thermobifida fusca YX
BAD58735     715 RVAKVEDVVNVGDKLRVEIADIDNRGKISLVP 746 Nocardia farcinica IFM 10152
AAT83219     693 RVEAVEDVLSVGQKIQVEIAEVDDRGKLSLVL 724 Propionibacterium acnes KPA171202
CAE49995     719 RIEKVEDVVNVGDKLEVEILDIDNRGKISLAP 750 Corynebacterium diphtheriae
AAO44518     705 HLESVDEVLSVGQKVLVEVSKIDDRGKLCLVA 736 Tropheryma whipplei str. Twist
AAT88793     709 RVESVDDVLSIGQKILVEITKIDDRGKLSLAP 740 Leifsonia xyli subsp. xyli str. CTCB07
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap