2H3X,1CUO,3AY2


Conserved Protein Domain Family
azurin

?
TIGR02695: azurin 
Click on image for an interactive view with Cn3D
azurin
Azurin is a blue copper-binding protein in the plastocyanin/azurin family (see pfam00127). It serves as a redox partner to enzymes such as nitrite reductase or arsenite oxidase. The most closely related copper-binding proteins to this family are auracyanins, as in Chloroflexus aurantiacus, which have similar redox activities. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131742
View PSSM: TIGR02695
Aligned: 13 rows
Threshold Bit Score: 203.852
Threshold Setting Gi: 24346361
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H3X_C           2 CDVSIEGNDSMQFNTKSIVVDKTCKEFTINLKHTGKLPKAAMGHNVVVSKKSDESAVATDGMKAGLNNDYVKAGDERVIA 81  Alcaligenes f...
Q50400          22 CEVNVSAGDSMAFNTRSIDIPKSCKEFTVNFAHTGTASKAGMGHNWVLARSADVNDLAKAGVEAGIDKNFIPPNDPRVLA 101 Methylobacill...
P00286           3 CKVDVDSTDQMSFNTKEITIDKSCKTFTVNLTHSGSLPKNVMGHNWVLSKSADMAGIATDGMAAGIDKDYLKPGDSRVIA 82  Pseudomonas c...
P12334          24 CSVDVEANDAMQYNTKNIDVEKSCKEFTVNLKHTGSLPKNVMGHNLVITKTADFKAVMNDGVAAGEAGNFVKAGDARVVA 103 Methylomonas ...
P07211          59 CAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGA-ADTDYVKPDDARVVA 137 Neisseria gon...
P00281           2 CDVSIEGNDSMQFNTKSIVVDKTCKEFTINLKHTGKLPKAAMGHNVVVSKKSDESAVATDGMKAGLNNDYVKAGDERVIA 81  Alcaligenes f...
AAN53885        32 CELKIAATDAMQFDTKELSVPATCKEVTLTLTHTGTLPKAAMGHNWVLTKAADMSAVATDGMGAGADAAYVKAGDSRVIA 111 Shewanella on...
uhmanoa:IL0600  24 CELSIDGNDNMRFDTKEMSVPASCDEVTVTLHHTGKLDKKVMGHNWVLSEAGDMQSVVQQGMSAGMDNNYVPDSD-AVIA 102 Idiomarina lo...
BAC62771        25 CEVSIDANDMMQFSTKTLSVPATCKEVTLTLNHTGKMPAQSMGHNVVIADTANIQAVGTDGMSAGADNSYVKPDDERVYA 104 Vibrio paraha...
AAM38265        24 CAVTITGNDQMKFDQSTIKLAPECTQVELTLKHSGKMAATVMGHNWVLTKSADFQAVANAGVRSTIADSYLPKADARVIA 103 Xanthomonas a...
P12335           3 CETTVTSGDTMTYSTRSISVPASCAEFTVNFEHKGHMPKTGMGHNWVLAKSADVGDVAKEGAHAGADNNFVTPGDKRVIA 82  Methylomonas ...
1CUO_A           3 CETTVTSGDTMTYSTRSISVPASCAEFTVNFEHKGHMPKTGMGHNWVLAKSADVGDVAKEGAHAGADNNFVTPGDKRVIA 82  Methylomonas ...
3AY2_A          43 CAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGA-ADTDYVKPDDARVVA 121 Neisseria gon...
2H3X_C          82 HTSVIGGGETDSVTFDVSKLKEGEDYAFFCSFPGHWSIMKGTIEL 126 Alcaligenes faecalis
Q50400         102 YTPLVGGGEKTSVTFKPSILKDGESYSFYCSFAFHSFMMRGTVKL 146 Methylobacillus flagellatus KT
P00286          83 HTKIIGSGEKDSVTFDVSKLTAGESYEFFCSFPGHNSMMKGAVVL 127 Pseudomonas chlororaphis subsp. chlororaphis
P12334         104 HTKLVGGGEKDSVKVDVSKLAAGEKYTFFCSFPGHATMMRGTVTV 148 Methylomonas sp. J
P07211         138 HTKLIGGGEESSLTLDPAKLADGD-YKFACTFPGHGALMNGKVTL 181 Neisseria gonorrhoeae
P00281          82 HTSVIGGGETDSVTFDVSKLKEGEDYAFFCSFPGHWSIMKGTIEL 126 Alcaligenes faecalis
AAN53885       112 HTGLVGGGESTSVTFSTAGMSPTEAYQFFCSFPGHRAIMQGSFKL 156 Shewanella oneidensis MR-1
uhmanoa:IL0600 103 ATDVIGGGEETSVTFSTEGMSADTDYKFFCTFPGHSAIMQGSFAI 147 Idiomarina loihiensis L2TR
BAC62771       105 HTKVVGGGESTSITFSTEKMTAGGDYSFFCSFPGHWAIMQGKFEF 149 Vibrio parahaemolyticus RIMD 2210633
AAM38265       104 HTKVIGGGDSTTVSFPTSKLSKGADYTFFCSFPGHWAMMKGTLTF 148 Xanthomonas axonopodis pv. citri str. 306
P12335          83 FTPIIGGGEKTSVKFKVSALSKDEAYTYFCSYPGHFSMMRGTLKL 127 Methylomonas sp. J
1CUO_A          83 FTPIIGGGEKTSVKFKVSALSKDEAYTYFCSYPGHFSMMRGTLKL 127 Methylomonas sp. J
3AY2_A         122 HTKLIGGGEESSLTLDPAKLADG-DYKFACTFPGHGALMNGKVTL 165 Neisseria gonorrhoeae FA 1090
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap