
Conserved Protein Domain Family

TIGR02695: azurin 
Click on image for an interactive view with Cn3D
Azurin is a blue copper-binding protein in the plastocyanin/azurin family (see pfam00127). It serves as a redox partner to enzymes such as nitrite reductase or arsenite oxidase. The most closely related copper-binding proteins to this family are auracyanins, as in Chloroflexus aurantiacus, which have similar redox activities. [Energy metabolism, Electron transport]
PSSM-Id: 131742
Aligned: 13 rows
Threshold Bit Score: 203.852
Threshold Setting Gi: 24346361
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q50400         102 YTPLVGGGEKTSVTFKPSILKDGESYSFYCSFAFHSFMMRGTVKL 146 Methylobacillus flagellatus KT
P00286          83 HTKIIGSGEKDSVTFDVSKLTAGESYEFFCSFPGHNSMMKGAVVL 127 Pseudomonas chlororaphis subsp. chlororaphis
AAM38265       104 HTKVIGGGDSTTVSFPTSKLSKGADYTFFCSFPGHWAMMKGTLTF 148 Xanthomonas axonopodis pv. citri str. 306
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap