Conserved Protein Domain Family
tRNA_CCA_actino

?
TIGR02692: tRNA_CCA_actino 
tRNA adenylyltransferase
The enzyme tRNA adenylyltransferase, also called tRNA-nucleotidyltransferase and CCA-adding enzyme, can add or repair the required CCA triplet at the 3'-end of tRNA molecules. Genes encoding tRNA include the CCA tail in some but not all bacteria, and this enzyme may be required for viability. Members of this family represent a distinct clade within the larger family pfam01743 (tRNA nucleotidyltransferase/poly(A) polymerase family protein). The example from Streptomyces coelicolor was shown to act as a CCA-adding enzyme and not as a poly(A) polymerase. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 131739
View PSSM: TIGR02692
Aligned: 10 rows
Threshold Bit Score: 755.41
Threshold Setting Gi: 50952425
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAT90126       5 AESLDRLAAIAASPTVARLAAAFAAAGHELSLVGGPIRDALLGREV--HDLDFTTDARPDAIVRLLSPLADAVWDIG-RA 81  Leifsonia xyli ...
AAT84007      38 LLEHRINALFEQIPLVAELGEAFAQAGHDLYLVGGSVRDALMGRLG--HDLDFTTDARPDDTEAILRQHTHATWDIG-RA 114 Propionibacteri...
CAB42723      15 EQHRAAREPLRVAPVADDLARRFQEAGFSLALVGGSVRDALLGRLG--NDLDFTTDARPQDVLKIMRPWADAVWEVG-IA 91  Streptomyces co...
CAE55651      10 LLTAAAVALNRHAALLRELGSVFAAAGHELYLVGGSVRDALLGRLs--PDLDFTTDARPERVQEIVRPWADAVWDTG-IE 86  Mycobacterium t...
BAD60508      16 LLASAAVTLGALADVLTPLGGLFAARGHELYLVGGSVRDAVLGRLG--TDLDFTTDARPEQVLEIMRGWADHVWDTGgLA 93  Nocardia farcin...
BAC19738      20 LMARAHQAVGELSPILTPLAAAFTEQGHSLYLVGGSVRDAFLGTLG--NDLDFTTSAPPEITRAILDDYAEVVWDTG-IA 96  Corynebacterium...
CAF19023      24 LMARAHQAIGELSDILVPLAAAFSSKGHSLYLVGGSVRDAFLGELG--HDLDFTTSARPEETKAILDDYADVVWDTG-IA 100 Corynebacterium...
CAE50890      28 LLVRAQKTLGLLSPLLSPLAQAFHDRGHRLYLVGGSVRDALLDELG--HDLDCTTDARPEVVSAILEEYAPVVWDTG-IE 104 Corynebacterium...
CAD67469       8 KLALSRLQKLSHEDSVLALTAAFCAKNYELALVGGPVRDCFLDRPV--VDLDFATNATPQETLRLVKPISSGCWTTG-AR 84  Tropheryma whip...
WP_011731631  10 LLAGALVALNRRAGVLRELGAVFAAAGHELYLVGGSVRDALLGRLTenSDLDFTTDARPEQMQKFLRGWSDALWDTG-IE 88  Mycobacterium s...
AAT90126      82 YGTIGAVFGEEAVEVTTYRSDSYDGTTRKPDVEFGDTLEGDLLRRDFTVNALALRVPEV---RLVDPSGGVEHLLARVLT 158 Leifsonia xyli ...
AAT84007     115 FGTIGAQIDDWVVEATTYRADAYHPDSRKPEIVYGETLKDDLIRRDFTVNAMALHAATR---TFSDPYAGLTDIVSGILR 191 Propionibacteri...
CAB42723      92 FGTVGGQKDGWQIEVTTYRSEAYDRTSRKPEVSYGDSIEEDLVRRDFTVNAMAVALPEK---VFIDPHGGLDDLAARVLR 168 Streptomyces co...
CAE55651      87 FGTVGVGKSDHRMEITTFRADSYDRVSRHPEVRFGDCLEGDLVRRDFTTNAMAVRVTATgpgEFLDPLGGLAALRAKVLD 166 Mycobacterium t...
BAD60508      94 FGTVSAAKAGQQLEITTFRSDTYDRVSRNPEVTFGDTLEGDLVRRDFTVNAMAVRIAADgslEFVDPLGGMDALLAGVLD 173 Nocardia farcin...
BAC19738      97 FGTLSAEKHGQQIEITTFRSDVYDGTSRNPEVTFGDTLDGDLIRRDFKVNAMAVEIAGDgtlSFHDPVGGLDDLLHRRLD 176 Corynebacterium...
CAF19023     101 FGTLSAEKHGQQIEITTFRSDLYDGNSRNPEVTFGDTLEGDLIRRDFKVNAMAVEIQADgelTFHDPVGGLEDLLTHTLD 180 Corynebacterium...
CAE50890     105 FGTVSAEKDGQQIEITTFRSDVYDGQSRNPEVQFGDTLEGDLIRRDFTVNAMAMEILPDgsmQFHDPVGGMNDLVAGLLD 184 Corynebacterium...
CAD67469      85 YGTVSARVKGRVVEITTYRSDNYSANTRKPKVSFGGSLEEDLIRRDFTVNAMAFRVPSG---QLVDISSGLQDIANKRLA 161 Tropheryma whip...
WP_011731631  89 FGTIGVGKGDDRLEITTFRADSYDQVSRNPTVEFGDNLGDDLVRRDFTINAMAVRITADgpgEFHDPLGGLAAARDKVLD 168 Mycobacterium s...
AAT90126     159 TPSSPEVSFGDDPLRMLRAARFAAQLGFEVDGQTQAAMAAMADRIEIVSAERIRDELGKLLMSDRPRPGIELLVSTGLAD 238 Leifsonia xyli ...
AAT84007     192 TPFPPERSFSDDPLRMMRAARFTSQLGFTVTNEVRAAMTDMASRIEIISAERVRDELSKTLLTDHPREGLDLLVTTRIAD 271 Propionibacteri...
CAB42723     169 TPGTPEDSFSDDPLRMMRAARFAAQLDFEVAPEVVKAMHDMAGRIDIVSAERVRDELNKLILSPHPRKGLSLLVETGLAE 248 Streptomyces co...
CAE55651     167 TPAAPSGSFGDDPLRMLRAARFVSQLGFAVAPRVRAAIEEMAPQLARISAERVAAELDKLLVGEDPAAGIDLMVQSGMGA 246 Mycobacterium t...
BAD60508     174 TPASPEDSFDDDPLRMLRAARFVSQLGFELAPRVRAAIGRMAEQIDRITAERVRVELDKLIAGDHPIDGIDIMCETGLAQ 253 Nocardia farcin...
BAC19738     177 TPAAPEQSFNDDPLRMLRAARFVSQLGFTVADCVVTAMTEMAGQISRITAERVQVELDKLMLGAHPEEGIDLMVDTGIAE 256 Corynebacterium...
CAF19023     181 TPATPEQSFNDDPLRMLRAARFVSQLNFTLAPRVITAMTEMAQQITRITVERMQVELDKMILGKNPEAGIDLMVESGIAQ 260 Corynebacterium...
CAE50890     185 TPATPQQSFNDDPLRMLRAARFVSQLGFDLAPRVRHAMTEMADQITRITAERVQVELDKMICGKVPWDGIDVMVDTGLAD 264 Corynebacterium...
CAD67469     162 TPIKPELSFADDPLRMLRAARLSSQLGFKISENSLLAMKDCAKRLKIVSAERVRGEFEKLLCCADPTGSLRVLVNTGLIN 241 Tropheryma whip...
WP_011731631 169 TPSAPEVSFGDDPLRMLRAARFVSQLGFSVAPRVLEALIEMAPQLERITAERVAAELDKLLLGADPVAGIDLMVQTGMGA 248 Mycobacterium s...
AAT90126     239 RVLPELSALRLEVDEHHHHKDVYQHSLTVLEQAIEYererhPGDAPELTLRLAALLHDIGKPATRRFEPGGAVSFHHHDV 318 Leifsonia xyli ...
AAT84007     272 YVLPELPALRLERDEHHRHKDVYEHSLTVLDQSIDLek--rRGHDPDLTGRLAALLHDIGKPSTRKFEPGGKVSFHHHDI 349 Propionibacteri...
CAB42723     249 RVLPELPALRLERDEHHRHKDVYDHTLIVLEQAMAL-----ESEGPDLTLRLAALLHDIGKPRTRRFEKDGRVSFHHHEV 323 Streptomyces co...
CAE55651     247 VVLPEIGGMRMAIDEHHQHKDVYQHSLTVLRQAIAL-----EDDGPDLVLRWAALLHDIGKPATRRHEPDGGVSFHHHEV 321 Mycobacterium t...
BAD60508     254 RVLPEVPAMKLEIDEHHQHKDVYRHSLTVLEQAIDL-----EDGDPDLVLRWAALLHDIGKPDTKRNEPGGGVSFHHHEV 328 Nocardia farcin...
BAC19738     257 VIFPEIPAMQMTQDEHMQHKDVYRHSLQVMRQSIDQ-----ETE-PDLVLRWAALLHDCGKPDTREFNEDGRVSFHQHEV 330 Corynebacterium...
CAF19023     261 IIYPEIPAMQMTQDEHMQHKDVYAHSLQVMRQAIDQ-----EEDGPDLVLRWAALLHDCGKPDTRDFNEEGRVSFHQHEV 335 Corynebacterium...
CAE50890     265 IIYPEISALRLTQDEHHQHKDVYAHSLTVLRQAMDQ-----EEDGPDVVLRWAALMHDCGKPDTREFSPEGRVSFHQHEI 339 Corynebacterium...
CAD67469     242 HFLPEISALRLEIDEHFHHKDVYEHSLIVLRQAIKLeqerfR-NGPDLVLRLAALMHDIGKPATRRKHPDGSVTFYHHDT 320 Tropheryma whip...
WP_011731631 249 VVLPEVGEMRMAIDEHHQHKDVYWHSLTVLRQAIDL-----EDDGPDLVLRWAALLHDIGKPATRKHEPDGGVSFHHHEV 323 Mycobacterium s...
AAT90126     319 VGAKLAKKRLTALRFDKATIESVSRLIELHLRFFGYTEGAWTDSAVRRYVRDAGPELERLHMLTRADVTTRNRRKADRLG 398 Leifsonia xyli ...
AAT84007     350 VGAKMARKRLKALTYPSQVVKEVSKLVELHLRFHGYGDQGWTDSAVRRYVRDAGDQLERLHILTRSDCTTRNRRKAERLE 429 Propionibacteri...
CAB42723     324 VGAKMTKKRMIALKYSNDLVRDVSRLVELHLRFHGYGTGEWTDSAVRRYVRDAGPLLDRLHKLTRSDCTTRNKRKASALS 403 Streptomyces co...
CAE55651     322 VGAKMVRKRMRALKYSKQMIDDISQLVYLHLRFHGYGDGKWTDSAVRRYVTDAGALLPRLHKLVRADCTTRNKRRAARLQ 401 Mycobacterium t...
BAD60508     329 VGAKMVRKRMRALKYPKQFTEDVARLVFLHLRFHGYGKGQWTDSAVRRYVTDAGDLLPRLHKLVRADCTTRNKRRASALQ 408 Nocardia farcin...
BAC19738     331 VGAKLVRRRMRKLKYSKQMVNDVSQLVFLHMRFHGFGEGQWTDSAVRRYVADAGELLPRLHKLVRADCTTRNKRKAQRLQ 410 Corynebacterium...
CAF19023     336 VGAKLVRRRMRKLKYSKQMVGDVGQLVFLHMRFHGFSEGQWTDSAVRRYAADAGELLPRLHKLVRADCTTRNKRKAARLQ 415 Corynebacterium...
CAE50890     340 VGARLMRHRMRALKYSKHTIRDVSELIRLHMRFHGFSEGEWTDSAVRRYVTDAGDLLPRLHKLVRADCTTRNKKKAERLQ 419 Corynebacterium...
CAD67469     321 VGAKMASKRLAAMRFDKNVIFAVTRLIQLHLRFFGYGDQSWTDSAVRRYVRDAGPQLERLHILTRADVTTRNQNKARRLR 400 Tropheryma whip...
WP_011731631 324 VGAKMVRKRMRALKYSKQMVEDVSQLVYLHLRFHGYGDGKWTDSAVRRYVTDAGPLLSRLHKLVRADCTTRNKRRAARLR 403 Mycobacterium s...
AAT90126     399 FAYDDLEQRIASLGEQEALDSVRPDLDGQQVMAILGIKPGRDVGQAMTYLLDLRLDQGSLGEEEATRRLLAWWS 472 Leifsonia xyli subsp....
AAT84007     430 FAYDDLEARIANLTAKEELAAIRPDLDGQQIMAILGIKPGPEVGKAYKFLLNLRLDEGPHTPDEAKNALLAWWA 503 Propionibacterium acn...
CAB42723     404 RAYDGLEDRIAQLQEQEELDAIRPDLDGNQIMEVLGVRPGPAVGQAYKHLLELRLENGPMEHDAAVAALKEWWA 477 Streptomyces coelicol...
CAE55651     402 ASYDRLEERIAELAAQEDLDRVRPDLDGNQIMAVLDIPAGPQVGEAWRYLKELRLERGPLSTEEATTELLSWWK 475 Mycobacterium tubercu...
BAD60508     409 ATYDELEERIARLQQEEDLAKVRPDLDGNAIMELLGLPPGPEVGRAWRYLKELRLDRGPLTREEAEAALVEWWK 482 Nocardia farcinica IF...
BAC19738     411 ATYDHLEERIADIAAREDLARVRPDLDGNEIMEILNIPAGPQVGKAWSFLKELRLERGPLERDDAIAELKAWWE 484 Corynebacterium effic...
CAF19023     416 ATYDHLEERIAEIAAKEDLARVRPDLDGNEIMEILNIQAGPEVGKAWAFLKELRLERGPLDREVAIAELKSWWE 489 Corynebacterium gluta...
CAE50890     420 KTYDHLEDRIADIAAKEDLAKVRPDLDGNEIMEILDIKAGPQVGQAWKFLKELRLERGPLEREDAILELKKWWY 493 Corynebacterium dipht...
CAD67469     401 AAYDNLEERIAKLREQEELDAIRPELNGEEIMSLLDLKPGKEVGVAYKYLLDLRLDNGPIGKQESARKLLLWWK 474 Tropheryma whipplei T...
WP_011731631 404 ANYDDLEARIAELAAKEDLQRVRPDLDGNEIMQILGIPPGPQVGEAWKYLKELRLERGPLSHDEAVDELLKWWN 477 Mycobacterium smegmatis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap