1JL3


Conserved Protein Domain Family
arsC_pI258_fam

?
TIGR02691: arsC_pI258_fam 
Click on image for an interactive view with Cn3D
arsenate reductase (thioredoxin)
This family describes the well-studied thioredoxin-dependent arsenate reductase of Staphylococcus aureaus plasmid pI258 and other mechanistically similar arsenate reductases. The mechanism involves an intramolecular disulfide bond cascade, and aligned members of this family have four absolutely conserved Cys residues. This group of arsenate reductases belongs to the low-molecular weight protein-tyrosine phosphatase family (pfam01451), as does a group of glutathione/glutaredoxin type arsenate reductases (TIGR02689). At least two other, non-homologous groups of arsenate reductases involved in arsenical resistance are also known. This enzyme reduces arsenate to arsenite, which may be more toxic but which is more easily exported. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 131738
View PSSM: TIGR02691
Aligned: 9 rows
Threshold Bit Score: 243.921
Threshold Setting Gi: 12724358
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JL3_A     6 IYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDA 85  Bacillus subtilis s...
CAD62750   4 IYFLCTGNACRSQMAEGFAQQLLGPNWQVASAGVETHGLNPLAVQVMSEVGIDISDQVSKLIDLTYLNQCAVVVTLCGDA 83  Lactobacillus plant...
AAK05471   4 VYFLCTGNSCRSQIAEGYGHKNLEG-WEVRSAEIETHGLNPRAVKVMAEEGIDISSQKSELIDLDYFNECDLIITLCGDA 82  Lactococcus lactis ...
AAD51847   7 IYFLCTGNSCRSQMAEAWGKKYLGDKWNVLSAGIEAHGVNPNAIKAMNEVDIDITDQTSVTIDRDILDKADLVVTLCGHA 86  Bacillus sp. CDB3
Q9K8K8     6 IYFLCTGNSCRSQMAEGWGKKYLGDEWDVYSAGIEAHGVNPNAVKAMKEIGIDISEQTSDTIDQELLQKADLVVTLCGHA 85  Bacillus halodurans...
P45947     6 IYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDA 85  Bacillus subtilis s...
P0A006     6 IYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDA 85  Staphylococcus aureus
AAM24256   6 LYFICTGNSCRSQMAEGFGKFYGGDDFEVYSGGVEAHGLNSKAVEVMKEIGIDISNQTSDLIDENILFKADYVITLCGDA 85  Caldanaerobacter su...
AAS08213   4 IYFLCTGNSCRSQMAEGYGKILLKDKYEVKSAGIEKHGLNPYAVKAMAEDGVDISQQKSKLIDPDYLNSADLVVTLCGDA 83  Lactobacillus johns...
1JL3_A    86 ADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEF 134 Bacillus subtilis subsp. subtilis str. 168
CAD62750  84 RDRCPVTPATVTRLHWPLPDPARTTGSVSDQLLVFRQVRDQIKARVIDL 132 Lactobacillus plantarum WCFS1
AAK05471  83 LDKCPMIPKGVNHEHWDLQDPACAIGSETEILAEFRKTRDLIKEKVKMI 131 Lactococcus lactis subsp. lactis Il1403
AAD51847  87 NDVCPTTPPHVKRVHWGFDDPAGQE------WSVFQKVRDEIGERIKKF 129 Bacillus sp. CDB3
Q9K8K8    86 ADVCPATPSNKERVHWGFDDPAKAEGTDEEKWAVFRRVRDEIGKRIKTF 134 Bacillus halodurans C-125
P45947    86 ADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEF 134 Bacillus subtilis subsp. subtilis str. 168
P0A006    86 DNNCPILPPNVKKEHWGFDDPAGKE------WSEFQRVRDEIKLAIEKF 128 Staphylococcus aureus
AAM24256  86 RDKCPALPPSVKSLHWELEDPARAEGTEEEIMNKFREVRDIIKEKVKAL 134 Caldanaerobacter subterraneus subsp. tengcongensis...
AAS08213  84 RDRCPALSPQTKNLHWPLIDPTQAQGTPEQKMVIFRQVRDEIKKRVADL 132 Lactobacillus johnsonii NCC 533
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap