2L17


Conserved Protein Domain Family
ars_reduc_gluta

?
TIGR02689: ars_reduc_gluta 
Click on image for an interactive view with Cn3D
arsenate reductase, glutathione/glutaredoxin type
Members of this protein family represent a novel form of arsenate reductase, using glutathione and glutaredoxin rather than thioredoxin for reducing equivalents as do some homologous arsenate reductases. An example of this type is Synechocystis sp. strain PCC 6803 slr0946, and of latter type (excluded from this model) is Staphylococcus aureus plasmid pI258 ArsC. Both are among the subset of arsenate reductases that belong the the low-molecular-weight protein-tyrosine phosphatase superfamily. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 131736
View PSSM: TIGR02689
Aligned: 4 rows
Threshold Bit Score: 252.9
Threshold Setting Gi: 35210564
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2L17_A     5 KKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCG 84  Synechocystis sp. P...
BAA18407   2 KKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCG 81  Synechocystis sp. P...
BAC87945   2 KKVMFVCKRNSCRSQMAEGYARTLGAGVIEVVSSGLEASRVHPTAVQVMAAAGVDIAGQISKPLSDFGSEDFDVVISLCG 81  Gloeobacter violace...
BAB73062   2 KKVMFVCKHNSRRSQMAEGFTKILGKDNIAVTSAGLAVSQIDPFAIEVMSEIGIDISNQTSKPLENFHPEEYDAVISLCG 81  Nostoc sp. PCC 7120
2L17_A    85 CGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLI 130 Synechocystis sp. PCC 6803
BAA18407  82 CGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLI 127 Synechocystis sp. PCC 6803
BAC87945  82 CGVNLPEAWLTREIFEDWRVEDPDGQPVEVFHRVRDEIKQRVQNLV 127 Gloeobacter violaceus PCC 7421
BAB73062  82 CGMNLPEAWVLRDIFEDWQLDDPQGESIETFRRVRDEIKERVVKLI 127 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap