Conserved Protein Domain Family
TIGR02688

?
TIGR02688: TIGR02688 
TIGR02688 family protein
Members of this family are uncharacterized proteins sporadically distributed in bacteria and archaea, about 470 amino acids in length. Several members of this family appear in public databases with annotation as ATP-dependent protease La, despite the lack of similarity to families TIGR00763 (ATP-dependent protease La) or pfam02190 (ATP-dependent protease La (LON) domain). This protein is repeatedly found downstream of another uncharacterized protein of about 880 amino acids in length, described by model TIGR02687. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131735
View PSSM: TIGR02688
Aligned: 6 rows
Threshold Bit Score: 639.836
Threshold Setting Gi: 18159212
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAR35481       9 LVDVFSGKVVRKD-LVRKVKVGANVPVFVLEYLLGKYCATDDEaAMEAGLRVVNNTLAENFVRPEEANKAQALVREKGR- 86  Geobacter sulfu...
AAM29860      17 LIQHFPGRVVRKD-LTKLLKVGHNVPVYVLEYLLGSYCADDDEeVIQEGIQIVKNILSQNYVRPDEAEKIKSRIRETGY- 94  Methanosarcina ...
AAS96494       8 INTHFPGLVVRKD-LVKTVKGNAIVPSYVLEYLLGQYCATSDEpTIQTGIETVKEILAKHYVHRNEAGLVRSNIKEKGR- 85  Desulfovibrio v...
AAL62653       8 VKRCFGDYAVDKR-LAYELEL-AKLPRYVAEFLISEFMTLGG-----DWEGKLRSFIRERYYEPEEKEVVKHKLVTEGV- 79  Pyrobaculum aer...
WP_012544181   9 IRDVFPDESVYKMpQNYGVFSGRNIPSFIKDWLIKKFTDEDGT-L---DKQGLLSYLDRFLPDKKQAQIIKKQLVQTQEp 84  Coprothermobact...
WP_012643236  18 VERVFRGLVIDKRrLPASQLQKRGVPAYVGEWLLDTLVPGRGE-LTEEEARKVREWAEKYVPGPNDQQIIKHRLLQGEV- 95  Thermomicrobium...
AAR35481      87 HTFIDKVKVRYLAEDDKYWAECVNFGHKYLH--IPERYIREYDRLLMGGVWAQMEIRHQy-dEEAKGrrSPFWIESITPI 163 Geobacter sulfu...
AAM29860      95 YTVIDKITVILNERRDIYEAEFSNLGLKNIE--IDSDYVIKYDKLLGGGIWCMIKMEYS---TESAS--SPFIISSLKPI 167 Methanosarcina ...
AAS96494      86 YKVIDKISVDLNDKKDVYQAQFSNLGLKEVL--VDSGTVKKHPKLLVGGVWCIADLEYEf-tEDKSA--SPWILSTLKPI 160 Desulfovibrio v...
AAL62653      80 VELIDELRVYVDVETGAHIGVIHAL-DIWAE--VPVDIVERNRATLTTGMWGLITLQRWegvREILGrpVSVVVTDFKPF 156 Pyrobaculum aer...
WP_012544181  85 YTVLARVQTQADIKKGIIRFSIPDFGIGPGEgiIPRSLIEAHPELMADEIWGIFTLVYEp---EDEHtpGHISVMDFKPF 161 Coprothermobact...
WP_012643236  96 IKVLTPVQVEVSLARATRSAKLRLLGIEDAA--ISDELPTRYPDLLRQGMWGVVELLSTg---------DGVAIQSFRPM 164 Thermomicrobium...
AAR35481     164 QLATFDLNAYQEGRRQFTSEEWVDMLIRSVGMEPEHFT-RRLKLLFLIRLIPLCEANYNLVELGPRGTGKSYAYQELSPY 242 Geobacter sulfu...
AAM29860     168 QIPNVNIQEILAERKNFTKDEWIDVLMRSIGMEPTQLE-TSTKWHMLERLVPLVENNYNLCELGPKSTGKSHVYKEISPN 246 Methanosarcina ...
AAS96494     161 QLSHFDFDGYVEARKQFTTDEWIDLLVQSIGFNPEMFG-KRSKLTQLVRLIPFCERNYNLIELGPKGTGKSHIYSEFSPH 239 Desulfovibrio v...
AAL62653     157 QAPDTDPKILEEGRGCFTLEEWVEVLINTIGLDPAVYS-PRQRLLLLARLVSLVEGNVNMAEFGPRQTGKTYLYRNVSNY 235 Pyrobaculum aer...
WP_012544181 162 KPYEVDLDYFKEGRKEFTLEEWIDVLIRAMEYMPTGFEsAQQKLLFLSRLLVFVEPRLNMIELAPKGTGKSYIFNNLTKY 241 Coprothermobact...
WP_012643236 165 QAS-LDLGLYKEARQEFTLDEWLRLMLTSMGYAPEAFT-AEEQLWLIARLLPLVQKNLHLVELAPKATGKSYFYENISPR 242 Thermomicrobium...
AAR35481     243 AILMTG-PTTVANLFFNISTNKMGLVGLWDAVAFDEVAD-LEKMPKEVVTTMKTYCESGSFAR-GKESLSGMASIALFG- 318 Geobacter sulfu...
AAM29860     247 TILMSGgQTTVANLFYNMGTRQIGLVGFWDVVAFDEVAG-IRFKDKDGIQILKDYMASGSFAR-GKEQKNANASIVFVG- 323 Methanosarcina ...
AAS96494     240 GILISGgEVTVPKLFVNNSSGKIGLVGYWDCVAFDEFAGkQKRVDKALVDIMKNYMANKSFSR-GVETLGAEASMVFVG- 317 Desulfovibrio v...
AAL62653     236 VRIISGgVISPAALFYNLRTKVPGELALKDAVVFDEVSKvRFPNPDEMMGKLKDYMESGHYER-GDKKVVSDASLVFMGn 314 Pyrobaculum aer...
WP_012544181 242 GWCISGgTVTRAKMFYDISRRSFGYITRYDFVALDEIETlKFAEEEELKGALKNYLELGKFTI-ADVTKTSEAGFMLLG- 319 Coprothermobact...
WP_012643236 243 VRLVSGgNITPAVLFVNNATGQWGLLARYAVVVLDEVQTlKFEKPEEIIGGLKGFLANGRLTRgGLHEASSDCSFVMLA- 321 Thermomicrobium...
AAR35481     319 -NTNQ--PVETMVKSSHLFIPLPEIVReDMAFLDRIHYYIPGWEIPKMR--IEYFTQHYGFVVDYLAEALRELRR-H-NF 391 Geobacter sulfu...
AAM29860     324 -NVNQ--SIESLLKTSHLFSPFPEAMNsDTAFFDRMHYYLPGWEIPKFR--PEHFTDRYGFIVDYIAEFFREMRK-R-SY 396 Methanosarcina ...
AAS96494     318 -NTQH--TVPYMLKHSDLFCELPDKFY-DSAFLDRIHFYIPGWEVDIIR--GEMFSNGYGFVVDYLAEILRSLRN-H-DY 389 Desulfovibrio v...
AAL62653     315 vSVEL--TSEGYVPVEDLTYVLPEPMR-DSAFIDRIHGLLPGWELPKISqsKYHLSKGYGVASDYFAEALHGMRK-E-SL 389 Pyrobaculum aer...
WP_012544181 320 -NIPL--TSEHKPINDIYFSHLPDFFR-DSALLDRFHGFIEGWHLPRIN--EDMKVSGYTLNVEFFSEILHKVRE-RsEY 392 Coprothermobact...
WP_012643236 322 -NVPLdeKQEPIIQQNSLVDYLPEFMR-ETAFLDRIKGLLPGWKIRKLS--KEAFANSVGLKADFFGDALLTLREdL-EI 396 Thermomicrobium...
AAR35481     392 TEVSDRYFSFGAH-LNARDVKAVRKTVSGLVKLLYPHGE----FTKDEL-AETVDIAMEGRRRVKEQLKKMGS 458 Geobacter sulfurreduce...
AAM29860     397 ADNINRFFKLGNN-LNQRDVIAVKKTFSGLMKLIYPDEN----ITREQA-QEILEYTLVGRRRVKEQLKKIGG 463 Methanosarcina mazei Go1
AAS96494     390 SDRYKDHFSLSSD-ISTRDRDGINKTFSGLMKILFPHGG----ATKEEV-EELLRFAIEGRKRVKDQLMRIDS 456 Desulfovibrio vulgaris...
AAL62653     390 SGLVGRHVELSEN-FKIRDEKSFKRITSGLLKLLFPDKT----FDKKEL-KTIAEFALELRQRVRDWLHKIAP 456 Pyrobaculum aerophilum...
WP_012544181 393 AAIVDELLDIPPK-ADTRDVTAVKRLCTAYLKILFPHITdssqITKEEFeTYCLKPALEKRAIVKRQIHLMDP 464 Coprothermobacter prot...
WP_012643236 397 DQYCARRIRLRGNrPYARNEIAVQALASGMMKILFPHGR----VSDWDFrHYCVEPAVQLRQGIWDLLYQLDG 465 Thermomicrobium roseum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap