2WD7,1MXH,1P33


Conserved Protein Domain Family
pter_reduc_Leis

?
TIGR02685: pter_reduc_Leis 
Click on image for an interactive view with Cn3D
pteridine reductase
Pteridine reductase is an enzyme used by trypanosomatids (including Trypanosoma cruzi and Leishmania major) to obtain reduced pteridines by salvage rather than biosynthetic pathways. Enzymes in T. cruzi described as pteridine reductase 1 (PTR1) and pteridine reductase 2 (PTR2) have different activity profiles. PTR1 is more active with with fully oxidized biopterin and folate than with reduced forms, while PTR2 reduces dihydrobiopterin and dihydrofolate but not oxidized pteridines. T. cruzi PTR1 and PTR2 are more similar to each other in sequence than either is to the pteridine reductase of Leishmania major, and all are included in this family.
Statistics
?
PSSM-Id: 131732
View PSSM: TIGR02685
Aligned: 6 rows
Threshold Bit Score: 471.72
Threshold Setting Gi: 1172740
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WD7_A     3 APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSN-------------V- 68  Trypanosoma brucei ...
AAN62582  11 CPAAIITGGARRIGHSIAVRLHQQGFRVVVHYRHSEGAAQRLVAELNAARAGSAVLCKGDLSLSS-------------S- 76  Trypanosoma cruzi
AAX79442 104 APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSN-------------V- 169 Trypanosoma brucei
P42556     7 APVALVTGAAKRLGSSIAEALHAEGYTVCLHYHRSAADASTLAATLNARRPNSAITVQADLSNVAtasfsetdgsvpvT- 85  Leishmania tarentolae
1MXH_A    11 CPAAVITGGARRIGHSIAVRLHQQGFRVVVHYRHSEGAAQRLVAELNAARAGSAVLCKGDLSLSS-------------S- 76  Trypanosoma cruzi
1P33_A     7 APVALVTGAAKRLGSSIAEALHAEGYTVCLHYHRSAADASTLAATLNARRPNSAITVQADLSNVA-------------Ta 73  Leishmania tarentolae
2WD7_A    69 ------------LPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHED----NSNGKTVETQVAELIGTNAIAPF 132 Trypanosoma brucei ...
AAN62582  77 ------------LLDCCEDIIDCSFRAFGRCDVLVNNASAYYPTPLLPGDDTNg---AAEAKPIDAQVAELFGSNAVAPL 141 Trypanosoma cruzi
AAX79442 170 ------------LPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHED----NSNGKTVETQVAELIGTNAIAPF 233 Trypanosoma brucei
P42556    86 ------------LFSRCSALVDACYMHWGRCDVLVNNASSFYPTPLLRKDAGEggssVGDKESLEVAAADLFGSNAIAPY 153 Leishmania tarentolae
1MXH_A    77 ------------LLDCCEDIIDCSFRAFGRCDVLVNNASAYYPTPLLPGDDTNg---AADAKPIDAQVAELFGSNAVAPL 141 Trypanosoma cruzi
1P33_A    74 sfsetdgsvpvtLFSRCSALVDACYMHWGRCDVLVNNASSFYPTPLLRKDAGEggssVGDKESLEVAAADLFGSNAIAPY 153 Leishmania tarentolae
2WD7_A   133 LLTMSFAQRQkGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA 212 Trypanosoma brucei ...
AAN62582 142 FLIRAFARRQ-GEGGAWRSRNLSVVNLCDAMTDLPLPGFCVYTMAKHALGGLTRAAALELAPRHIRVNAVAPGLSLLPPA 220 Trypanosoma cruzi
AAX79442 234 LLTMSFAQRQkGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA 313 Trypanosoma brucei
P42556   154 FLIKAFAQRVaDTRAEQRGTSYSIVNMVDAMTSQPLLGYTMYTMAKEALEGLTRSAALELASLQIRVNGVSPGLSVLPDD 233 Leishmania tarentolae
1MXH_A   142 FLIRAFARRQ-GEGGAWRSRNLSVVNLCDAMTDLPLPGFCVYTMAKHALGGLTRAAALELAPRHIRVNAVAPGLSLLPPA 220 Trypanosoma cruzi
1P33_A   154 FLIKAFAQRVaDTRAEQRGTSYSIVNMVDAMTSQPLLGYTMYTMAKEALEGLTRSAALELASLQIRVNGVSPGLSVLPDD 233 Leishmania tarentolae
2WD7_A   213 MGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA 268 Trypanosoma brucei brucei
AAN62582 221 MPQETQEEYRRKVPLGQSEASAAQIADVIAFLVSKDAGYITGTTLKVDGGLILARA 276 Trypanosoma cruzi
AAX79442 314 MGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA 369 Trypanosoma brucei
P42556   234 MPFSVQEDYRRKVPLYQRNSSAEEVSDVVIFLCSPKAKYITGTCIKVDGGYSLTRA 289 Leishmania tarentolae
1MXH_A   221 MPQETQEEYRRKVPLGQSEASAAQIADAIAFLVSKDAGYITGTTLKVDGGLILARA 276 Trypanosoma cruzi
1P33_A   234 MPFSVQEDYRRKVPLYQRNSSAEEVSDVVIFLCSPKAKYITGTCIKVDGGYSLTRA 289 Leishmania tarentolae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap