Conserved Protein Domain Family
upstrm_HI1419

?
TIGR02683: upstrm_HI1419 
putative addiction module killer protein
Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the upstream member of a gene pair, where the downstream member is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family pfam01381. These gene pairs, when found on the bacterial chromosome, often are located with prophage regions, but also in both integrated plasmid regions and near housekeeping genes. Analysis suggests that the gene pair may serve as an addiction module.
Statistics
?
PSSM-Id: 162974
View PSSM: TIGR02683
Aligned: 23 rows
Threshold Bit Score: 125.009
Threshold Setting Gi: 39650744
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC19557       2 VEIVASATFDRWLRKLKNRRAAARALVRIDRLAANNPGDVKPVGGGISELRIDYGPGCRVYFLRERDRLVLLLTGGDKST 81  Corynebacterium...
tigr:BMA2689   2 FKVLTPPQFDKWLDGLRDPVGSAAINLRIERAKLGNLGQWRAVGDGVNEMKIDVGPGYRAYFVRRGKIIVVVLCGGDKST 81  Burkholderia ma...
CAD85267      11 YIVKRLDEFDKWLDGLKDRPTRIRLIRRLDKARQGLLGDVKSVGEGVFEMREFFGSGWRMYYIQQGGTIILMLGGGDKST 90  Nitrosomonas eu...
CAF23720      10 ETANGKRPFEIWIKEIKEIHTRAKILTRLDRLKLGNFGDCKTLQKGVHELRIHYGPGIRIYYGKIGNKVILLLCGGDKGS 89  Candidatus Prot...
CAE13360       8 LTSDNRDLYMEFLKGIRDPIAKSKISSRVNRMATGNFGDNKPCREGVWELRIDQGPGYRVYYSLVGREVVLLLVGGDKRT 87  Photorhabdus lu...
CAE29267      16 YSADRESPFADWLDGL-DVMAAAKVTTAVARLSLGNLSNVKSVGEGVLETKIDFGPGYRIYFGRDGDTLVILLCGGTKKR 94  Rhodopseudomona...
WP_010996558  12 LRLDGIDIFSDWFDSLRDRKAKAKIRARLDRVENGNLGDCKSVGDGVFELRIDYGSGYRIYFGQEGLTIIILLCGGDKST 91  Nostoc sp. PCC ...
WP_010895178  17 YTVKRLEEFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDKST 96  Xylella fastidiosa
WP_011333453   3 YFVQQTSVFETWHASIRDLRAKVAIARRIDRASAGNLGDIKPVGDGVSEMRVDVGAGYRVYFTMRNGVVIVLLAGGDKSS 82  Pseudomonas flu...
WP_011059021   2 FVFEQTPEFSRWLLNLKDPQGKTRVLARIRAAQLGRFGDCEPVGEGVHEIRIHRGPGYRVYFSRHGKMIYLLLIGGDKAT 81  Pseudomonas pro...
BAC19557      82 QETDIKAAHAIADIW 96  Corynebacterium efficiens YS-314
tigr:BMA2689  82 QKKDIKLAKQIAGEL 96  Burkholderia mallei ATCC 23344
CAD85267      91 QSKDIQKAIQLANDL 105 Nitrosomonas europaea ATCC 19718
CAF23720      90 QDKDIAKAMEYLKDY 104 Candidatus Protochlamydia amoebophila UWE25
CAE13360      88 QDADIDQAIECLKDY 102 Photorhabdus luminescens subsp. laumondii TTO1
CAE29267      95 QRSDIARAIVYWRDY 109 Rhodopseudomonas palustris CGA009
WP_010996558  92 QDKDIAKAKEYWEDY 106 Nostoc sp. PCC 7120
WP_010895178  97 QQSDIRRAIELAKSL 111 Xylella fastidiosa
WP_011333453  83 QSADIRRAKNMAKEv 97  Pseudomonas fluorescens
WP_011059021  82 QKRDIQRARQLACDL 96  Pseudomonas protegens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap