Conserved Protein Domain Family

TIGR02681: phage_pRha 
phage regulatory protein, rha family
Members of this protein family are found in temperate phage and bacterial prophage regions. Members include the product of the rha gene of the lambdoid phage phi-80, a late operon gene. The presence of this gene interferes with infection of bacterial strains that lack integration host factor (IHF), which regulates the rha gene. It is suggested that pRha is a phage regulatory protein. [Mobile and extrachromosomal element functions, Prophage functions]
PSSM-Id: 131728
Aligned: 4 rows
Threshold Bit Score: 165.374
Threshold Setting Gi: 49177375
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
AAT52751  98 VAMSYITPEAMKMKIKFLQEFKRMKEHIQKVQ 129 Bacillus anthracis str. Sterne
AAK03858  98 LVMGFTGKKAMQFKEQYIKEFNEMKKRLATRA 129 Pasteurella multocida subsp. multocida str. Pm70
P45197    86 LVMGYRTQKAMKFKVEFIKAFDFMREKLQQEG 117 Haemophilus influenzae Rd KW20
AAS96654  80 VAMGYTGPKAMRMKEAYIRRFNEMERTLAHGP 111 Desulfovibrio vulgaris str. Hildenborough
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap