Conserved Protein Domain Family

TIGR02677: TIGR02677 
TIGR02677 family protein
Members of this protein belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). [Hypothetical proteins, Conserved]
PSSM-Id: 131724
Aligned: 5 rows
Threshold Bit Score: 523.617
Threshold Setting Gi: 51857053
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
BAD59283     500 HLTELQSGETAEIHTAAGVFRGPDHLLWIEVRGG 533 Nocardia farcinica IFM 10152
CAI09882     471 RLEPLETHTRAEVVTDAGIFAGRDHLITITDTQA 504 Aromatoleum aromaticum EbN1
BAD74602     463 VVNVVNKEGTICLRAEDGELVMPNYEIHVLSRGE 496 Geobacillus kaustophilus HTA426
BAD41211     459 TAEVKADAPLGRLSAADGTATLPHVILRLHKGGP 492 Symbiobacterium thermophilum IAM 14863
WP_003959515 468 VLSPPPDGRTAVLRTAQGTMTGPDYVIHITAVGG 501 Streptomyces clavuligerus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap