Conserved Protein Domain Family
TIGR02677

?
TIGR02677: TIGR02677 
TIGR02677 family protein
Members of this protein belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131724
View PSSM: TIGR02677
Aligned: 5 rows
Threshold Bit Score: 523.617
Threshold Setting Gi: 51857053
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAD59283      29 RPFAHVHAANADLYRAIMGSFAAAKRRFTVHLRPDDVLHALRAAQFPADEQ--SVAAALDQLCEWRNLRADPDTSR-VTT 105 Nocardia farcin...
CAI09882       9 DLFRHVSADKAGIYRSIMASFAAAKRQFRLHMRPDEVLAEARWTDGVPKLE--EVQAALAQLAEWGNLEAQPDTAR-VAS 85  Aromatoleum aro...
BAD74602      10 VETKYLSTENAHRYRAILRYFYIQHERMRQYLFPEEVYAFLKQHEEFADYTeeELQQDLDQLVKWNNLIARQETSH-VRT 88  Geobacillus kau...
BAD41211      12 EANYLIGHPDGKYYRLLMRCFYERSLSHITYVRTDDLVAFVQQYLPYDDAT---CRQHLDQMEKWGLVTLIPEQSK-PAN 87  Symbiobacterium...
WP_003959515   7 EMFRFITGETADLNGAVLEAFGVAGEHLETELGLDGVRERLRAVGWVSDLQdeELHEALKRLVKWELLDVVHNHAQnYRT 86  Streptomyces cl...
BAD59283     106 VEDFRRARFLYQLTGEGEAAETALVTYDEALGRRG-ALQSVALTDIVTHLRALLRLVDDP---VPDEG-LVYASLTALAG 180 Nocardia farcin...
CAI09882      86 ISDFYRARFLYRLSHGGEAVETALAAFAAALGRRA-ELQTVALEDIANRLKTLLALADAP---TPDAA-KVHETLRDLVR 160 Aromatoleum aro...
BAD74602      89 IEEFKKKRFRYQCSPYTVEIERMIRTLEQLGDSFGgSLEKTRFDRLYASLSRIEAIIASG---FQEQRdEMYQVWEETFD 165 Geobacillus kau...
BAD41211      88 LMELRQKPRVYQASRIALRLEALRAELEQEEGAAS--LDPAALDLLVQRVRELADFIEQDglhRDGAApEAHRLWAGVYE 165 Symbiobacterium...
WP_003959515  87 AEEYERRNLHYSLTRRGEAALAGVRHALEVLASTG-ALQTAVLEAIADRLDELTVLSGEH---SAADR-RIFSTLRELEG 161 Streptomyces cl...
BAD59283     181 RFADLADNAQAFMSSLQNVTDLQDAEIEAFLSYKDRLIDYLERFIKSLVTTGAEIAVLIRELDgHRVDRLLDLAAEREAA 260 Nocardia farcin...
CAI09882     161 VFESLADNAQAFMAGMARSIELQQADATAVLAYKQRLIDYLERFIGDLVGRSGAIAQHIASLH-PRIDPLLWAAAQREAR 239 Aromatoleum aro...
BAD74602     166 YFKKIIQNSADYMAYLHSENVEERMTSESFLVYKEQFTAYLRDFIVALQKTSMQIEQLLENLPeDGVRQFIGHVVDYERS 245 Geobacillus kau...
BAD41211     166 SFGAFSRRIREYLEDLPRHRPREVLDYEAFRAYRDLLIPYLQDYARRLFDRREQLRMRLRVLArSKELLATTAAVVEAQQ 245 Symbiobacterium...
WP_003959515 162 HLESLVENTKAFNGQLQRLLRAEGVDLDVFREVKAATVAYIQEFLVNLDRRGETVAAAVARVEeRGIAVLRERALRGAEL 241 Streptomyces cl...
BAD59283     261 DAAPdgtdDYRERAVIRHRTLWRERWDGFHSWFIGRDGRTEQAALLRGAARSAVPRVLAVVAALNDRRAGRSDRSADFRT 340 Nocardia farcin...
CAI09882     240 DAAPgd-dQAQADALAQRQQAWRERWGGLRGWFVSTHHEPPQAEVLRSKARAAIPQLLAAVAALNERRSGRSDRSADFRV 318 Aromatoleum aro...
BAD74602     246 IPRF----ADAPPPRPMQIEEKWETWRSLCEWFLGRNGRESELLFLQYQTNEAIRRLTRVVQRLGERHHHFRSRKGDYLH 321 Geobacillus kau...
BAD41211     246 VRAD---------GSRPDFDRQKERFLREIDALIGYFGDQGDVDVLLERAQAWVSEITRHARRLSEQHLGGSVREQTLLD 316 Symbiobacterium...
WP_003959515 242 PPTP------GEDPAAGWLESRRARWAGLRAWFLPDGGARPRIEQLHDIARRAIVSLLQVLERINESRRRPSSVVQDFRE 315 Streptomyces cl...
BAD59283     341 LAVWFAQAPDDEARHALWRSAFGLHSARHLTIDADtvearERQPVAPATSWTDAPPIEIS-PRLRATGSYERRGRANKVI 419 Nocardia farcin...
CAI09882     319 LAGWFATCASDDDAHRLGRAAFALNPARHFSLNPG-----AGHELPATTPWAEAPPLRIH-PRLREYGEAAPRGPLPKVR 392 Aromatoleum aro...
BAD74602     322 LARWFSRLESIEEAHCLSAVVFGCFHTKHLVADTE------ATDNIYRDVWDEPPAEWVTkPRVRHYGEKK---KPQAIE 392 Geobacillus kau...
BAD41211     317 LARRFSECTSLEQAESLAQVVFAATLPLHWRGEAP--------PPADKDPWEAEP---VTvPLYAVRRGQRPRQQPEATA 385 Symbiobacterium...
WP_003959515 316 LARWFAAAPDEEDLHRLWSAAFGLGPARHAHLAHP-----DPELIPSSHSWSDAPPVKVS-ALLRTSGRTERFTRTAKVR 389 Streptomyces cl...
BAD59283     420 DRSVERRYLAELAAKEAAQTRQALAELtaVAGHPVRLSAVGALNEKAFRLFLGLLGDALTAKSPGSAEVTTTTSDGSVTV 499 Nocardia farcin...
CAI09882     393 ERNEERALLARQLREEHLQVEAARARL--ATGRTTRLSEIGHLDPHAFALFLSLLGEALTAQSSPEDVVERQTGDGLLRI 470 Aromatoleum aro...
BAD74602     393 DKEREKEEARLRYLEEKAREEAELKQF--VTDGKIVLADLPEVTPYVRKTLLGWIAKAMGREGQ-----AMKTENG---W 462 Geobacillus kau...
BAD41211     386 DRTSEALQKMLSAKAERDRAAQELAELf-GDESELDLGDLTVREPRQRQLLLRLLYKALSQQGP------VGVGYRNWSV 458 Symbiobacterium...
WP_003959515 390 DVTEVRAERAERARAERAELARAWQAL--ETDGPVRLSSFRALDPMVFDRLLDLLGRALAARRDADGRRRATTGDGRAEV 467 Streptomyces cl...
BAD59283     500 HLTELQSGETAEIHTAAGVFRGPDHLLWIEVRGG 533 Nocardia farcinica IFM 10152
CAI09882     471 RLEPLETHTRAEVVTDAGIFAGRDHLITITDTQA 504 Aromatoleum aromaticum EbN1
BAD74602     463 VVNVVNKEGTICLRAEDGELVMPNYEIHVLSRGE 496 Geobacillus kaustophilus HTA426
BAD41211     459 TAEVKADAPLGRLSAADGTATLPHVILRLHKGGP 492 Symbiobacterium thermophilum IAM 14863
WP_003959515 468 VLSPPPDGRTAVLRTAQGTMTGPDYVIHITAVGG 501 Streptomyces clavuligerus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap