Conserved Protein Domain Family
cas_cyan_RAMP_2

?
TIGR02674: cas_cyan_RAMP_2 
CRISPR-associated RAMP protein, Csx10 family
CRISPR is a widespread repeat family in prokaryotes. At least 45 different protein families occur in prokaryotes only when these repeats are present. This family, a minor CRISPR-associated protein family, seems largely restricted to the Cyanobacteria. It belongs to the RAMP superfamily (pfam03787).
Statistics
?
PSSM-Id: 131722
View PSSM: TIGR02674
Aligned: 4 rows
Threshold Bit Score: 532.903
Threshold Setting Gi: 501215119
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010995647   1 MKRIELTIKALSPLAIGKQKPGGSINEAERYIPGSVLRGAIAKHILQRaGRELENLATNGgDFADLFLAENPAIFQNAYP 80  Nostoc sp. PCC ...
WP_011429768   1 MEAIELTLTAESPLAIGRQKPGGSISEAQDFIPGSVIRGALADLLLRQ-SRHRPGEALTG-DLAALFTEARAAVFTHAYP 78  Synechococcus s...
WP_012258137   1 MNIIPYRVTLLEPLLATRIAGDPNSGVSYPYVPGSLVRGAAVAMYARN-K-GIVAVDAREeEARRLFFDGRTRYLN---- 74  Chloroflexus
WP_012258156   1 ---MWLKIKPNNPLILGDVRASSQFLSPTQYIPGRILRGAWAEWLLIQ-GRQDILPTVQRvRIGNFFPTTEWRPICYALP 76  Chloroflexus
WP_010995647  81 avakvgskhqvvdnnikVLPATAVSSKANPGFLPKG------H-GVFDTLIDSFCAEQFQHS--YDPsslkALEQGVDPR 151 Nostoc sp. PCC ...
WP_011429768  79 gsg------------srVLPATAFSSKNNPGFRSEAg----kT-GVFDTLLDRFCSQRLGIP--FDP----AEPDGSGGR 135 Synechococcus s...
WP_012258137  75 -----------------AYPADASGRRTLPTPRSLF------HvEGEESPIYDFALEVIDAV--N------EETVQFVGA 123 Chloroflexus
WP_012258156  77 ------------------LPLSALTCKQASGFKKEPhpdnqgH-GVVDALIPQLAYSLLERAgaCFAapfvLTCLTCGSR 137 Chloroflexus
WP_010995647 152 VETYNSLYSKHn----EQYCTHAATSRLLTRVGINRYRATSSDDILYSIEVLNEAfivaNEGKNQEWDNYVYRGYINVSN 227 Nostoc sp. PCC ...
WP_011429768 136 VEPFGGFYSQEe---gSRYRRVAVSKRLLTRVGINRRRATAADQILYSLEVINEG----RAGRDGSLQPSLFSGHIYLQD 208 Synechococcus s...
WP_012258137 124 ARDSQPFCRIDds--nIFFISPKRRINVHTQRDRVKGRATEVSGAVFQYDALEE--------------GQTFAGWVLVDK 187 Chloroflexus
WP_012258156 138 MEAITGFYTVYrdgttERYCQSRLRYHSQTKVGISRYRRAAVEQVLYTANALSPV----TVQPDEKVSDLVFLGRIYGER 213 Chloroflexus
WP_010995647 228 DELATKLTNFINnnsEVFRLGGSVSRGLGKVEITAKEIPVA-DDISSRIHVFNQALHKRWQDWsEAFGDGLRPAKSD-RT 305 Nostoc sp. PCC ...
WP_011429768 209 RELAAALAGYLNthaRRLSLGGGVSRGLGRVSLAARHLRAPkPSLAERVAAFNQKLRQRWQQW-QVFGNPWQPLPPE-RQ 286 Synechococcus s...
WP_012258137 188 DDDVELLSSLLR---HIYRLGGSSNSGYGRVTVAVDAPQNI-Q-VWREIPKQIVPIDAGETFVvTLLSDTLVRDPNT-GQ 261 Chloroflexus
WP_012258156 214 SDVADLIEAIN-----HIAIGALHTRGYGRVKAEEAEVVGF-PDIEERVRLFNEILVHCWQDLkSLATNAEDLPAKPeGT 287 Chloroflexus
WP_010995647 306 pnptskrtFFTLNLHSDVILTEDwqrttvISPEMLQQFADVEDPSLKLHTAYSSYSYTSGWNSAWGLMKDVELVTNKGSV 385 Nostoc sp. PCC ...
WP_011429768 287 --------YFSIGLQSGAILKERwqrttvLTPPMLQEEANCEDGSLVLELACSSYAYVSGWNAAWGLFKDVELVTTQGSV 358 Synechococcus s...
WP_012258137 262 --------Y-TWDLRPALQQLLS------VEIEHIHPIAGEEEQ-----RSVWRLDEVGGFNRAWGLPLPQAQAIAGGSV 321 Chloroflexus
WP_012258156 288 --------YFSVDLLSPGVFQD-------SGIPALAPILRINGQALEPVWWMTRPDFAGGWSTAWGLPKPTNLAARMGSV 352 Chloroflexus
WP_010995647 386 YLFSTE-NRQLWEDALSSLELRGVGDRTCEGFGQVEICNEFHQIFR--ENPV 434 Nostoc sp. PCC 7120
WP_011429768 359 FLLSTT-QMERWIPILAEMEYWGIGERTAEGFGQIEVCSLFHHHFW--ENPL 407 Synechococcus sp. JA-3-3Ab
WP_012258137 322 FVFRAR--SPIPAQTIAGAEWDGIGERRAEGFGRLAFNWQTETELIrvDPPV 371 Chloroflexus
WP_012258156 353 YVYRWDgTLDEIISTLQTLEEQGVGKRRDEGFGEFLVCHPFHQEVE--EK-- 400 Chloroflexus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap