Conserved Protein Domain Family
FtsE

?
TIGR02673: FtsE 
cell division ATP-binding protein FtsE
This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein. [Cellular processes, Cell division]
Statistics
?
PSSM-Id: 131721
View PSSM: TIGR02673
Aligned: 11 rows
Threshold Bit Score: 328.054
Threshold Setting Gi: 46451199
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
macrogen:ZMO0416   4 IVQFDHVHFAYn-AGADILSDLNLTFEPGQFYFVTGASGAGKTSLLKMIYMALRPYRGSVRIFGEDVMTLPERYIPSLRQ 82  Zymomonas m...
AAS97844           1 MLDIRHLSHNY--GSHWALKDCSFTLEKGGFLFLSGPSGAGKTTLLRLLHGALPLQRGQAQVAGFDLARLRSHDLPALRR 78  Desulfovibr...
AAR35152           1 MIQFHNVSMSYq-RDMAALNDVTLKVPKGDFVFVTGPSGAGKSTLLKLVYAALSPSKGQVIVDGQNVTRMTRSQIPLLRR 79  Geobacter s...
CAG37282          11 MIEMIKVTKQYp-PNIAALHDISISISAGEMLFLIGRSGAGKTTLLKLLCGMETPSAGLIEINGTATNDLHGNALAKLRQ 89  Desulfotale...
BAC88590          21 IACLHNVSKIYp-NGCRGLHSVNLQIRKGDFLFITGPSGAGKSTLLKLLYGAEMPTEGQVEIEGNLFHRLRGRALAHLRR 99  Gloeobacter...
BAC08005          37 IAELYQVTKSFg-GAVPCLHRVSLQLRRGDFYFLTGASGSGKSTLLKLLCGQLQPDQGIVRLFGEEVNPHQDRRMAQLRR 115 Thermosynec...
CAE77835           1 MIEFSHVYKTYp-GPVHALKNVDLRIDKGEFVFLTGPSGAGKTTLFKMISAYDIATSGDVKVAGHDLLTMRDSQIPFFRR 79  Bdellovibri...
WP_011715147       5 MVRFHNVSLRYa-TGFEALHNISFHIKPGQFIFLTGHSGAGKTSILKLIYQAETPSEGAILLNNRNIEHLPHKQLPALRR 83  Magnetococc...
WP_002211504       1 MIRFEQVSKAYl-GGRQALQGVDFHLRPAEMAFLTGHSGAGKSTLLKLICGIERPSAGHIWFGGHDISRLKNREVPFLRR 79  Yersinia
WP_002965062       1 MIRFENVGLRYg-MGPEILRDVSFHIPPRSFQFLTGPSGAGKTSLMRLLFMALKPTRGLINIFGKDVARLDHKEIPLLRR 79  Brucella
WP_010888189      64 VIEFRQVTLEYpaTHTLALDNLTVSVTKGEFVYLVGHSGAGKSSFMNLILKRALPTRGEVRVAGQPLSHYRGRRTPLLRR 143 Deinococcus...
macrogen:ZMO0416  83 RIGIVFQDFRLVPELNVFDNIALPLRLDRRKENFIHSTVGRILVQIDLPDKAFHFPETLSGGEQQRIAIARALIRRPEIL 162 Zymomonas m...
AAS97844          79 HVSVVFQDFRILPARTAFANIALPLEVRGLDARASGRRVRAVARALGLEHRLDTPAGELSGGEQQRVAVARAIVVNPQVL 158 Desulfovibr...
AAR35152          80 SVGVVFQDFKLLPNRTVLENVAITLEVLGWGKRDIGKKVHHILRLMGMEHKINATPLRLSGGEQQRVALARALVNDPKIL 159 Geobacter s...
CAG37282          90 KIGVAYQDFRLLLNRTVAENIAISMEVSYKKPQLIQKRVKDLLEQLDLSDKHDTIAEELSRGEQQRITLARSVANSPTMI 169 Desulfotale...
BAC88590         100 RIGVVFQDYQLIPTKTVEENVAVVLHAQGACRTEIQRRVGPTLRMVGLAPKAKCFPDQLSGGEQQRVSIARAVVHTPPLL 179 Gloeobacter...
BAC08005         116 RLGVIFQDFKLLGDRSVAENVAFALLVRGIPKTEIQQRVQTALKLVGLSHKANAKPQSLSGGEQQRVSIARAIVGSPELL 195 Thermosynec...
CAE77835          80 KIGVIFQDFKLLKDRTIFENVALPLQVRGDKAPSIQRRVYEVLEQVGLAHKHDQYPDFVSGGEQQRTAIARAIIHQPGVL 159 Bdellovibri...
WP_011715147      84 GIGVIFQDYKLLYDRTVYENVALAMEVAGQPTDKIEIQVERTLEYVGLKERMFHNPIALSGGEQQRVAIARAIVNRPPLV 163 Magnetococc...
WP_002211504      80 QIGMIFQDHHLLLDRTVYDNVAMPLIIAGASSEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVL 159 Yersinia
WP_002965062      80 RIGIVFQDFRLLDHMTTYENVALPLRVRGKEEATYRHEVEELLHWVGLGDRMRVLPPVLSGGEKQRAAIARALIDQPELL 159 Brucella
WP_010888189     144 HMGTVFQDNLLLSHLNAYDNVAFALRVIGVPGREWPERVSAALRLVGLEHKKHALPMQLSLGEQQRVAIARAIVSDPPLL 223 Deinococcus...
macrogen:ZMO0416 163 VADEPTGNIDDGLAASILHLLSALSKRGMTVIMATHDLHLLDRVpHAKHIRLGTKG 218 Zymomonas mobilis subsp. mobilis ZM...
AAS97844         159 LADEPTGNLDPDLSLRLMDVFMQFNAYGTTVVLATHNPELIRRNpAARLIHLDDGM 214 Desulfovibrio vulgaris str. Hildenb...
AAR35152         160 LADEPTGNLDDENKEQILAIFREANIRGTTVMVATHDRRVIENS-HKRVIILDKGR 214 Geobacter sulfurreducens PCA
CAG37282         170 LVDEPTGNLDATTTTRVMDLLKKSNKAGATIVIATHDSSLYDNT-SHRVCELRHGE 224 Desulfotalea psychrophila LSv54
BAC88590         180 LADEPTGNLDAHNAWSVLQILKRLHDLGVTVIVTCHNEQLVEAF-ARRVVRIEAGI 234 Gloeobacter violaceus PCC 7421
BAC08005         196 LADEPTGNLDSQTSQQILALLHRLHQHGLTVLFTTHDLALTRLV-PHRILHLHHGK 250 Thermosynechococcus elongatus BP-1
CAE77835         160 IADEPTGNLDPRLSEEIMDLLERVCSQGTTVFVATHDHEMVRRR-KKRTLQLQDGM 214 Bdellovibrio bacteriovorus HD100
WP_011715147     164 IADEPTGNLDKAMGQRIMGLFQSLHQQGTTIIVVTHDVEMAQQM-GHPIIIMEDGQ 218 Magnetococcus marinus
WP_002211504     160 LADEPTGNLDDALSEGILRLFEEFNRVGVTVLMATHDTSLIARR-RYPILTLSQGR 214 Yersinia
WP_002965062     160 LADEPTGNVDPPLAKRLLRLFTELNRSGTAVIIATHDLSLMDQV-NARRMILDQGR 214 Brucella
WP_010888189     224 LADEPTGNLDPDHSREVLRVLQGVHLRGTTVVVATHARDLVETY-RHRTLTLRRGK 278 Deinococcus radiodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap