Conserved Protein Domain Family
cas_csm6

?
TIGR02672: cas_csm6 
CRISPR type III-A/MTUBE-associated protein Csm6
Members of this family as found in CRISPR-associated (cas) gene regions in Streptococcus thermophilus CNRZ1066, Staphylococcus epidermidis RP62A, and Mycobacterium tuberculosis (strains CDC1551 and H37Rv), as part of Mtube-type CRISPR/Cas systems. CRISPR is a widespread form of direct repeat found in archaea and bacteria, with distinctive subtypes each of which has a characteristic sporadic distribution.
Statistics
?
PSSM-Id: 131720
View PSSM: TIGR02672
Aligned: 3 rows
Threshold Bit Score: 479.034
Threshold Setting Gi: 55738904
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:SE2456      61 IQTVSPNTEVEIIIEN-VDNAQDYDVFKEKFHKYLKIIEDSY-EDCEIILNVTSGTPQMESTLCLEYIVYPENKKCVQVS 138 Staphylococc...
crjinra:str0965   1 MFSIAPNYEPELIIHDpIISDNEVHIFDVMFQRFSDILQEYYtKEDEFILNLSSATPQIKSALFVINRLNGINIKAVKVW 80  Streptococcu...
AAK47210         70 ITRLAPETDVRIVTYT-NPSVHRFDLFVPVFRNHLVELSAEF-PDRTILLNTSSGTPAMQAALVAINVFGIPRTTAVQVS 147 Mycobacteriu...
tigr:SE2456     139 TPTKDSNA--GIEYSNPKDKVEEFEIVNEVEKKSEKRCKEINILSFREAMIRSQILGLIDNYDYEGALNLVSNQKSFRNG 216 Staphylococc...
crjinra:str0965  81 SPEHASNE--NIGHDNDENIDELIKVNEDNKVNFIDRTIEDNAEKFSQALLKKTARDFIEKFDYKAALDILDQLSDFPNL 158 Streptococcu...
AAK47210        148 TPARALSKpgDRESPDAYDLELMWDANDDNQPGAPNRCFEATSAALGALLERANLKQLIVSYDYSAAVTIAADSRLPDQV 227 Mycobacteriu...
tigr:SE2456     217 K-------------------LLRKKLLSLTKQIKTHEVFPEINEKYRDDALKKSLFHYLLLNMRYNRLDVAETLIRVKSI 277 Staphylococc...
crjinra:str0965 159 KslreeirdvvnclskkkiaYIREKLYDFSRVFKNQSILSDILSFPLDDSQKKALNYYLMIDVLKEREHIADVLIKAKSL 238 Streptococcu...
AAK47210        228 Sn------------------LIRGAMHRSRLEHLVAPKFFKDTAFTYDPAN-KVAEYISALALLAKREQWAEFARSATPA 288 Mycobacteriu...
tigr:SE2456     278 AEFILKTYIEIHWPTLIIEKDGKPYLND---------EDNLSFVYKYNLLLEKRKQNFDVSRILGLPAFIDILTILEPNS 348 Staphylococc...
crjinra:str0965 239 AEFVIEEIIKKDHEGLIVFDGNLPKLNPsfpdceailDDIDKKMKKSRGIEDTEERIFSVQSTLNLLSYLNILEFYEYDS 318 Streptococcu...
AAK47210        289 ITIVLRAAVAKHLPEDRYLDD-MGRVDR----------RKLEREPEIRCALKHPPKSPNAEWYLYTKDWLALLRQFAPDR 357 Mycobacteriu...
tigr:SE2456     349 QLLKEVNAVNDINGLRNSIAHNLDtlNLDKNKNYKKIMLSVEAIKNMLHISFPEIEEEDYNYFEEKNKEFKEL 421 Staphylococcus epid...
crjinra:str0965 319 QLQTAINGILSLNGERNKVAHGLS--EIDTRLLSRKKLKQLSENLRLLLVDCLGIDSSYFNYYDKQNKELTKM 389 Streptococcus therm...
AAK47210        358 VGALEVLGRFESR-VRNTAAHEIVsiSEDR---ITKDGGLLPEQLLKILARETGADLTLYDRLNDEIIRQIDM 426 Mycobacterium tuber...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap