Conserved Protein Domain Family
cas_csx9

?
TIGR02671: cas_csx9 
CRISPR-associated protein Cas8a2/Csx9, subtype I-A/APERN
Members of this family, so far, are archaeal proteins found in CRISPR-associated (cas) gene regions. So far, this rare cas protein is found in only three genomes: Pyrococcus horikoshii shinkaj OT3, Pyrococcus abyssi GE5, and Thermococcus kodakarensis KOD1. In each case it is found immediately upstream of cas3 in loci that resemble the Apern type but lack Csa1 and Csa4 genes.
Statistics
?
PSSM-Id: 131719
View PSSM: TIGR02671
Aligned: 3 rows
Threshold Bit Score: 705.918
Threshold Setting Gi: 499169865
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAD84640      23 MSWVVMDAGIEPDEEELADTLEGALKSLGSRVKIHTSKMGRNDRSSFDKVLKAWFGRSAPETYGELFELVVTETIKLLRD 102 Thermococcus ko...
WP_010885009   1 MSWVVMEAGLEPDKEELIEALEGALNSLESRTRINTSKIGRNDRNSFNDVLQAWFNRSTPETYGELFELVIRETIKLLKE 80  Pyrococcus hori...
WP_010868141  23 FSWIVMDAGLSPNPNDFADAIENSMDTLKKRAMMNSSRIGKNDRNSYDRVFSKWFGVKAPDTYMELFELVINETIKLLRS 102 Pyrococcus abyssi
BAD84640     103 GNIDPGESLSTIKTDKNGTYLGIAYNGEQAILPAIIKQPEYYERQSGFLSPTTGQKAQIRMDPLWFSFMALGFFTSFAGF 182 Thermococcus ko...
WP_010885009  81 DKIDPSASLSTIKTDKNGTYLGVVYKEKQAILPAILKQPEYYEYQSSFLKPTTARKAQIRMDPLWFSFMALGFFTSFAGF 160 Pyrococcus hori...
WP_010868141 103 GKIDPAKSLQSITRNKNGTYLGQAYNGEYAITPAVIKQPEYYEFQSEFLKPTAGQKAQIYLDPLWFSLLSMGFLTAFAGY 182 Pyrococcus abyssi
BAD84640     183 IGGKYYLMTKPGIEVFWPYEVEEIIEKGILPLTGAGASGRISLSTEELYEMKLAMKLAEEGRDVIEEVYPVTLHLISLEG 262 Thermococcus ko...
WP_010885009 161 ISGKYYLITKPGIEGFWPYEVEDIIEHGILPLTSAGASGRISLTTEELYEMKLAMKLAEEEKNIIDEVYPVTLHVISLEG 240 Pyrococcus hori...
WP_010868141 183 IRKRYYLMTKPGIEVYFP-DVEEILIDGIIALTDAGISSRARLDAEELYELRIVMKLAEEGRKVPEMTYPIALH-ISLEG 260 Pyrococcus abyssi
BAD84640     263 QVYTELKTTQLNLTGLSEYMEEYVNRIESASMGGLPILVELKAGNATIQKYPLWALVDIAERELWKGVNGDGEMLAYIFV 342 Thermococcus ko...
WP_010885009 241 QSYTELKTIQLNLIELNNYITEYVKKIRASKVGSMSLLVELKEGGATVKKYPLWALVDIAEKEVWKGVKGDEEMLAYIFV 320 Pyrococcus hori...
WP_010868141 261 QVYTELKTLQLDLKELSNYLATYVKKIENYRVMGVDLKVKLKEG----EKYPLWALVDIAEKELNKGVSGDRELLAYIFV 336 Pyrococcus abyssi
BAD84640     343 KDLYRAINSGRRELIRDAVFRLFRQGRALLEGSGRASGEFRKVMKTFMWQEHLEVLL 399 Thermococcus kodakarensis KOD1
WP_010885009 321 KDLYRAINSGKKDIIQDSIFRLFRQGRALLEGSSRGSGEFRKVMRTFMWEEHLGVLL 377 Pyrococcus horikoshii
WP_010868141 337 KDLYRAVNSGRKELIEDSIFRLFRQGRGLLEGEGRASGELRKVLRVFMQEDHLEVLI 393 Pyrococcus abyssi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap