1R2K


Conserved Protein Domain Family
moaB_proteo

?
TIGR02667: moaB_proteo 
Click on image for an interactive view with Cn3D
molybdenum cofactor biosynthesis protein B, proteobacterial
This model represents the MoaB protein molybdopterin biosynthesis regions in Proteobacteria. This crystallized but incompletely characterized protein is thought to be involved in, though not required for, early steps in molybdopterin biosynthesis. It may bind a molybdopterin precursor. A distinctive conserved motif PCN near the C-terminus helps distinguish this clade from other homologs, including sets of proteins designated MogA. [Biosynthesis of cofactors, prosthetic groups, and carriers, Molybdopterin]
Statistics
?
PSSM-Id: 131715
View PSSM: TIGR02667
Aligned: 11 rows
Threshold Bit Score: 270.446
Threshold Setting Gi: 13421103
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1R2K_B         6 EFIPTRIAILTVSNRRGEEDDTSGHYLRDSAQEAGHHVVDKAIVKENRYAIRAQVSAWIASDDVQVVLITGGTGLTEGDQ 85  Escherichia coli
AAM35830       6 DFIPLRLCVLTVSDSRTLADDRSGDYLADVLTHEGHVLHERALCPDDRYRMRAIVSGWIADAQVDGILITGGTGFTGRDS 85  Xanthomonas axo...
P30746         7 EFIPTRIAILTVSNRRGEEDDTSGHYLRDSAQEAGHHVVDKAIVKENRYAIRAQVSAWIASDDVQVVLITGGTGLTEGDQ 86  Escherichia coli
AAK22003      16 PFTPVRVAVLTITDTRDEASDTSGQILVERIKAAGHELGGRVVVRDDIEQIRAQVRSWIDSKTVDAIVTTGGTGLTGRDV 95  Caulobacter cre...
CAE31825       5 KQVSLACAILTVSDSRSAGDDTSGNMLAESLAHAGHMCVRRDLVKKDLYQIRRVISEWIADPAVQVILVSGGTGFTPRDC 84  Bordetella bron...
WP_011045363   8 TFVPLNIAVLTVSDTRSEENDTSGQALVERLTQAGHNLADKAIVIDDVYQLRAQVSKWIADDSIHAIISTGGTGFTARDN 87  Colwellia psych...
WP_011335273   8 PFVPLNIAVLTVSDTRTLETDTSGQVFVDRLTAAGHHLAQRVLLKDDLYKIRAQVAHWIAEDVVQVVLITGGTGFTGRDS 87  Pseudomonas flu...
WP_009313403   8 TFQPLNIAILTVSDTRTLETDTSGQTLADALLAAGHRLHQRSLKTDDIYQIRAVVSAWIADPEVQVGLITGGTGFTARDN 87  Pseudomonas
tigr:MCA2156   5 EFLPLSIAILTVSDTRTEDDDSSGRVLVGRLTEAGHRLAEKCIVPDDIYRIRAVVSRWIADPDIQVVISTGGTGVTGRDG 84  Methylococcus c...
WP_012537664  12 AFLPLAIAILTVSDSRKPETDKSGDKVAELASHAGHQIAARQIIADDAETLRAQMRDWIADPAIDVIIATGGTGVTGRDV 91  Acidithiobacill...
WP_010971023  16 PFIPLGIAVLTVSDSRTLENDKSGDTLVARLEEAGHRLAARAIVPDDKAAIAETVREWTLSEGVDVVITTGGTGFTGRDV 95  Agrobacterium f...
1R2K_B        86 APEALLPLFDREVEGFGEVFRXLSFEEIGTSTLQSRAVAGVANKTLIFAXPGSTKACRTAWENIIAPQLDARTRPCNFHP 165 Escherichia coli
AAM35830      86 TPEAITPLLDKVMPGFGEMFRAISVEEIGTSSLQSRAFAGLANHSFVFCLPGSTSACRTAWEKIVRAQLDARTKPCNLAT 165 Xanthomonas axo...
P30746        87 APEALLPLFDREVEGFGEVFRMLSFEEIGTSTLQSRAVAGVANKTLIFAMPGSTKACRTAWENIIAPQLDARTRPCNFHP 166 Escherichia coli
AAK22003      96 TVEALEPLFDKKIDGFSVVFHLVSYASVGLSTLQSRATAGLIESVFVFCLPGSNGAVKDGWDKVIAAQLDSRHKPCNMVE 175 Caulobacter cre...
CAE31825      85 TAQAIEPLFDKTIEGFGELFRQLSYEEIGSSAVQSSALAGTANDTVIFCMPGSNHACKLGWNRIIREQLDDAHKPCNFAM 164 Bordetella bron...
WP_011045363  88 TPEALTPLFDKAVEGFGEVFRHVSLLEIGTSTIQSRAFGGIANKTVVLCVPGSTNACKTAWDKVIKEQLDASHRPCNFVP 167 Colwellia psych...
WP_011335273  88 TPEAVACLLDKQVDGFGELFRQISVPDIGTSSVQSRALAGLANGTLVCCLPGSTNAVRTGWDGILAEQLDSRHRPCNFVT 167 Pseudomonas flu...
WP_009313403  88 TPQAVGPLFERDVEGFGELFRQVSQREIGTSTIQSRALAGLSNGTLVCCLPGSPGACRTAWNEILLAQLDSRTRPCNFVP 167 Pseudomonas
tigr:MCA2156  85 TPEAVSVLFDKTLDGFGEVFRAISYQEIGTSTIQSRAIAGVANGTYVFALPGSSGACRTAWDKLIRQQLDLRTRPCNLAE 164 Methylococcus c...
WP_012537664  92 TPEALAPLISKPIPGFGELFRMLSFQEIGTSTIQSRAEAAICDGTIVFLLPGSTGGVRLGMEAIIIPQLDIRHAPCNLSE 171 Acidithiobacill...
WP_010971023  96 TPEALEPLFEKRMDGFSALFHRISYDKIGTATIQSRATGGVANATFIFVLPGSPGACKDAWDGILKAQLDYRHLPCNFVE 175 Agrobacterium f...
1R2K_B       166 HLK 168 Escherichia coli
AAM35830     166 LRP 168 Xanthomonas axonopodis pv. citri str. 306
P30746       167 HLK 169 Escherichia coli
AAK22003     176 LMP 178 Caulobacter crescentus CB15
CAE31825     165 HYR 167 Bordetella bronchiseptica RB50
WP_011045363 168 HLN 170 Colwellia psychrerythraea
WP_011335273 168 HLK 170 Pseudomonas fluorescens
WP_009313403 168 HLK 170 Pseudomonas
tigr:MCA2156 165 LIP 167 Methylococcus capsulatus str. Bath
WP_012537664 172 LLP 174 Acidithiobacillus ferrooxidans
WP_010971023 176 IMP 178 Agrobacterium fabrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap