Conserved Protein Domain Family
nitr_red_assoc

?
TIGR02664: nitr_red_assoc 
conserved hypothetical protein
Most members of this protein family are found in the Cyanobacteria, and these mostly near nitrate reductase genes and molybdopterin biosynthesis genes. We note that molybdopterin guanine dinucleotide is a cofactor for nitrate reductase. This protein is sometimes annotated as nitrate reductase-associated protein. Its function is unknown.
Statistics
?
PSSM-Id: 131712
View PSSM: TIGR02664
Aligned: 5 rows
Threshold Bit Score: 181.589
Threshold Setting Gi: 35211150
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:BMA0202   9 LFNFEIESSEDLTYIPMIVRFNLDRFGLRISLEQWQMLPLEDRRLLARFPADEDVVIEPnFDHALFEMLRTHANVEPSWF 88  Burkholderia ma...
BAC08908       4 FFEFEAEFTASLRCIPMIVRYKLDLCGVKLKLLHWHQLSQQQRQWLVVAPCNTPEDQAT-YRQQLRDWVTHNHGTPPSDL 82  Thermosynechoco...
CAE08980      11 CFAFEQDFIGTWRCIPLCVRRKLDLAGVKLKLSHWLALTQNQRQELVDWS-DAANALDQ-LRQYLRDLTEGMADGVVKDL 88  Synechococcus s...
BAC88529       6 LLFFEQDFWPELDCIPMGVRYKLDLCATKVSLRHWQLLATAEREELIALACENGEQVDR-YRERLGALAR-QHDFPLVPI 83  Gloeobacter vio...
WP_010994790   4 FFEFESDFVDSLRCIPMQVRYKLDTCGIKLKLADWNQMTQAEREALVELPCTTAAEIQS-YQEYIQHLIINRTGTPPGNL 82  Nostoc sp. PCC ...
tigr:BMA0202  89 QPDEHPAWRSVDAVPDALVAQSGLAGLPAPSASQWATLTPFQRYVLTKLSRKPKLNHDFVPAMREF 154 Burkholderia mallei ATCC 23344
BAC08908      83 EIPQTFPWDILTELPETVQQQLTKVPHHSLTVEKWATLTPLQRFALVKLSQPGHENRNFWPALQEF 148 Thermosynechococcus elongatus...
CAE08980      89 PPAVGAAWQQQSVLPAEIHRAAVARG-VELTPEQWAHVTELERFALCKLVRPGHDHHNLDAAFSEV 153 Synechococcus sp. WH 8102
BAC88529      84 DPDP-APWQ-------------AEVPRLAMEAPLWRAMNPFERFVCLKAQASSKQAELLPRVLALL 135 Gloeobacter violaceus PCC 7421
WP_010994790  83 PIDSKPAWLDSSSIPDSIEDKAQEIG-VTLTLSQWVNLTPLQRFALIKLSRSGHENKNFPKAIAEF 147 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap