Conserved Protein Domain Family

TIGR02663: nifX 
nitrogen fixation protein NifX
Members of this family are NifX proteins encoded within operons for nitrogen fixation in a number of bacteria. NifX, NafY, and the C-terminal region of NifB all belong to the pfam02579 and are involved in MoFe cofactor biosynthesis. NifX is a nitrogenase accessory protein with a role in expression of the MoFe cofactor. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Central intermediary metabolism, Nitrogen fixation]
PSSM-Id: 131711
Aligned: 9 rows
Threshold Bit Score: 177.154
Threshold Setting Gi: 34483456
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
BAC47012          76 AAARVVASKIHPIKV-SKPESIHVLLEKLESVLKGTPPPWLRKVL 119 Bradyrhizobium diazoefficiens USDA 110
CAE30055          75 GAARVVAAQVHPLKL-AQPELITDLITKLQGVLRGVPPPWLRKAL 118 Rhodopseudomonas palustris CGA009
macrogen:ZMO1828 106 AAAKVVNAGIHPVKL-PAEESIASIIKRVQEMMKGNPPPWLRKAM 149 Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
P19078            99 SAARMVRAGMHPIKR-KEPEPISAVIEQVQVMLNGTPPPFLRKVL 142 Rhodobacter capsulatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap