Conserved Protein Domain Family
nifX

?
TIGR02663: nifX 
nitrogen fixation protein NifX
Members of this family are NifX proteins encoded within operons for nitrogen fixation in a number of bacteria. NifX, NafY, and the C-terminal region of NifB all belong to the pfam02579 and are involved in MoFe cofactor biosynthesis. NifX is a nitrogenase accessory protein with a role in expression of the MoFe cofactor. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 131711
View PSSM: TIGR02663
Aligned: 9 rows
Threshold Bit Score: 177.154
Threshold Setting Gi: 34483456
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAR36199           1 MKVAFTSTTGEMIDEHFGMAKQFQIWDITPEGASFVETIAIG--AHGDDEE-----DKIAARANALKECAIVYTMAIGGP 73  Geobacter s...
CAE10454          18 IKVAFASKDSEFVNEHFGWARQFFIYEVSERGFRLAEIIKHD--EEDEDEE-----GKIDRRIEGIKEAGILYCQAIGPT 90  Wolinella s...
BAC47012           1 MKVAFATQDLRRVDAHFGWAKNIAIYDVAPSGHVFLKAIEFEgdLEEDGSG-----DKLAPKIQAIKDCAILYVAAIGGA 75  Bradyrhizob...
CAE30055           1 MKVAFATQDLARVDAHFGWARNIAIYEITADDYRFIEAVQFAeeKE-DGNE-----DKLVAKIDAIRDCAIMYCTAIGGS 74  Rhodopseudo...
BAB52280          26 LRVAIATQDMTNLNAHFGSAKRFAVYDVTREEWHLVEAVAFDdvSDESGKRrtegdDRVTPKVEALKGCHLLFCLAIGGP 105 Mesorhizobi...
macrogen:ZMO1828  27 LRIAIATNDMKSLNAHFGGANRFSIWDVTSDDAHFVEALGFQktSDQSGSHie-geDSITPKVEALADCKLLFILAIGGP 105 Zymomonas m...
P19078            20 LRVAIASNDLENLDAHFGSARQIAVYEVWKTGARFVEVHQFSsaTDQKGRHde-leDRIGPKLEALSGCTLVFALAVGGP 98  Rhodobacter...
WP_010967436      26 LRIAIATEDMKGLNAHFGSAKRFAIYDVTAHKSQFMEAIEFDdaSDESGRHrtegdGRIRSRVSALKGCQLLFCLAIGGP 105 Sinorhizobi...
WP_010995608       1 MKIAFTTSDRIHINSHFGSAKEIDVYEINAEGYQFLETLNFEgeLKEDGNE-----DKVAPKLAALADCAIVYVVAIGGT 75  Nostoc sp. ...
AAR36199          74 AAAKLVALKIHPMKT-NTPVSLQETVGRLRDVLKGNPPPWLRKAM 117 Geobacter sulfurreducens PCA
CAE10454          91 AAAKVVRAKIHPIKV-NEEKSIKEALEELTKMLAGNPPPWIKKIL 134 Wolinella succinogenes
BAC47012          76 AAARVVASKIHPIKV-SKPESIHVLLEKLESVLKGTPPPWLRKVL 119 Bradyrhizobium diazoefficiens USDA 110
CAE30055          75 GAARVVAAQVHPLKL-AQPELITDLITKLQGVLRGVPPPWLRKAL 118 Rhodopseudomonas palustris CGA009
BAB52280         106 SAAKVISAKIHPIKV-PQPQTIQEVLLRTQMMLRTCPPPWLRKVL 149 Mesorhizobium loti MAFF303099
macrogen:ZMO1828 106 AAAKVVNAGIHPVKL-PAEESIASIIKRVQEMMKGNPPPWLRKAM 149 Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
P19078            99 SAARMVRAGMHPIKR-KEPEPISAVIEQVQVMLNGTPPPFLRKVL 142 Rhodobacter capsulatus
WP_010967436     106 SAAKVISAKIHPIKA-QQAVSMSQVLSSVETMLQTAPPPWLRKML 149 Sinorhizobium meliloti
WP_010995608      76 AAAKLIKKGVTPVKArSEEESISELLNKLVQTLKGNPPPWLRKAL 120 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap