2WOC,3G9D


Conserved Protein Domain Family
dinitro_DRAG

?
TIGR02662: dinitro_DRAG 
Click on image for an interactive view with Cn3D
ADP-ribosyl-[dinitrogen reductase] hydrolase
Members of this family are the enzyme ADP-ribosyl-[dinitrogen reductase] hydrolase (EC 3.2.2.24), better known as Dinitrogenase Reductase Activating Glycohydrolase, DRAG. This enzyme reverses a regulatory inactivation of dinitrogen reductase caused by the action of NAD(+)--dinitrogen-reductase ADP-D-ribosyltransferase (EC 2.4.2.37) (DRAT). This enzyme is restricted to nitrogen-fixing bacteria and belongs to the larger family of ADP-ribosylglycohydrolases described by pfam03747. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 131710
View PSSM: TIGR02662
Aligned: 7 rows
Threshold Bit Score: 503.558
Threshold Setting Gi: 500032158
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WOC_A        11 VHDRALGAFLGLAVGDALGATVEFMTKGEIAQQYGIHRKMTGGGWLRLKPGQITDDTEMSLALGRSLAA-KGTLDVADIC 89  Rhodospirillum ...
P14300         6 VHDRALGAFLGLAVGDALGATVEFMTKGEIAQQYGIHRKMTGGGWLRLKPGQITDDTEMSLALGRSLAA-KGTLDVADIC 84  Rhodospirillum ...
AAR36194      10 LRSRAKAAFIGLAVGDALGAPVEFMTTGEIKAKHGVLREIVGGGWLRLKPGQVTDDTDMSLCVARGVAK-AGEWNLTAIA 88  Geobacter sulfu...
AAF61907       6 IRSRALGAYLGLDCGDALGATVEFLTKGEIAHQYGVHKHIKGGGWLKLPAGQVTDDTEMSIHLGRAILA-APEWDARRAA 84  Azospirillum br...
3G9D_A         6 IRSRALGAYLGLACGDALGATVEFLTKGEIAHQYGVHKHIKGGGWLKLPAGQVTDDTEMSIHLGRAILA-APEWDARRAA 84  Azospirillum br...
WP_009567497   5 LRERALGAYLGLAIGDALGATVEFMSPTEIREEYGVHRNMTGGGWLHLRPGQVTDDTQMCLVLGRSILA-DEQWSVTRFA 83  Acidithiobacill...
WP_011712876  16 IEARAVAAYWGMAMGDALGATVEFMMPAEIKAKYGRHDQIIGGGWLHLKKGQVTDDTTMALALGEAILErSGKFDPIAIG 95  Magnetococcus m...
2WOC_A        90 EEFALWLKSRPVDVGNTCRRGIRRYMHE---GTTTAPYSEGDAGNGAAMRCLPAALATLG-HPADLEPWVLAQARITHNH 165 Rhodospirillum ...
P14300        85 EEFALWLKSRPVDVGNTCRRGIRRYMHE---GTTTAPYSEGDAGNGAAMRCLPAALATLG-HPADLEPWVLAQARITHNH 160 Rhodospirillum ...
AAR36194      89 EEFAAWLRSKPVDVGDTCRRGIRNYMLK---GLLETPFNQWDAGNGAAMRMLPTALFTMG-DDNLLCRCAVEQGHLTHNH 164 Geobacter sulfu...
AAF61907      85 EEFAVWLKGVPVDVGDTTRRGIRRFIMH---GTLSEPESEYHAGNGAAMRNLPVALATLG-DDAAFERWTVEQAHITHCN 160 Azospirillum br...
3G9D_A        85 EEFAVWLKGVPVDVGDTTRRGIRRFIMH---GTLSEPESEYHAGNGAAMRNLPVALATLG-DDAAFERWTVEQAHITHCN 160 Azospirillum br...
WP_009567497  84 EGMVQWLRSHPVDVGNTCRRGIRRFMLN---GSTAAEPAEWDAGNGACVRNLPAVLATLS-APATFRRISVEQAHLTHHH 159 Acidithiobacill...
WP_011712876  96 DAFDRWMQSKPVDCGNTVRRGIVHFRQHrqsGQVMVPEGEFDGGNGTCMRTLPLALATLGmADEEMVQASRMQSHITHNH 175 Magnetococcus m...
2WOC_A       166 PLSDAACLTLGRMVHHLIGGRGMKACRE-EANRLVHQHRDFHFEPYKGQSS--AYIVDTMQTVLHYYFVTDTFKSCLIQT 242 Rhodospirillum ...
P14300       161 PLSDAACLTLGRMVHHLIGGRGMKACRE-EANRLVHQHRDFHFEPYKGQSS--AYIVDTMQTVLHYYFVTDTFKSCLIQT 237 Rhodospirillum ...
AAR36194     165 PLSDAACITLGRLVHLSVLGFSKPRLRR-EADRLTESHPTFSFEPYRGLAT--GYVVDTMQTVLHFFFRGRDFEECLVST 241 Geobacter sulfu...
AAF61907     161 AMSDAATLTLGHMVRRLVLGGSVRDVRD-ESNKLIAKHRPFKFQPYRGLAT--AYIVDTMQTVMHYYFQTDSVESCVVET 237 Azospirillum br...
3G9D_A       161 AMSDAATLTLGHMVRRLVLGGDVRDVRD-ESNKLIAKHRQFKFQPYRGLAT--AYIVDTMQTVMHYYFQTDSVESCVVET 237 Azospirillum br...
WP_009567497 160 PLSDVATLTLGEMLRCALRGEGVSSVRR-LADALVARYPEFAFKEIPQAPT--PYIVDTVRAVLYALLHTDNFKDCLIAV 236 Acidithiobacill...
WP_011712876 176 PLADAGTECINRMLHIALHGGSLADMSTgPVQRLINEHKTFTYRRKREPSNpdGFIVDTLRAVFFSLFSTDSFESCLIDV 255 Magnetococcus m...
2WOC_A       243 VNQGGDADTTGALAGMLAGATYGVDDIPSGWLSKLDMKVEREIRRQVDALLALAG 297 Rhodospirillum rubrum
P14300       238 VNQGGDADTTGALAGMLAGATYGVDDIPSGWLSKLDMKVEREIRRQVDALLALAG 292 Rhodospirillum rubrum
AAR36194     242 VNQGGDADTTGAIIGMVAGAYYGMEEIPRRWLKKMDRQVLDEIDTLSDLLISLSP 296 Geobacter sulfurreducens PCA
AAF61907     238 VNQGGDADTTGAIAGMLAGATYGVETIPPRWLRKLDRKVYDEICAQVDGLLARSP 292 Azospirillum brasilense
3G9D_A       238 VNQGGDADTTGAIAGMLAGATYGVETIPPRWLRKLDRDVYNEICAQVDGLLARAP 292 Azospirillum brasilense
WP_009567497 237 VNQGGDADTTGALAGMLAGGLYGTYGLPGTWLQRLDPAVQKEIAAQVDQLLIRGE 291 Acidithiobacillus ferrooxidans
WP_011712876 256 VNRGGDADTTGAIAGMVAGALYGLPGLPKAWFKALDAEVVRACEAQAVALIRTNT 310 Magnetococcus marinus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap