
Conserved Protein Domain Family

Click on image for an interactive view with Cn3D
methylamine dehydrogenase (amicyanin) light chain
This family consists of the light chain of methylamine dehydrogenase light chain, a periplasmic enzyme. This subunit contains a tryptophan tryptophylquinone (TTQ) prothetic group derived from Trp-114 and Trp-165 of the precursor, numbered according to the sequence from Paracoccus denitrificans. The enzyme forms a complex with the type I blue copper protein amicyanin and cytochrome. Electron transfer procedes from TQQ to the copper and then to the heme group of the cytochrome. [Energy metabolism, Amino acids and amines]
PSSM-Id: 131707
Aligned: 4 rows
Threshold Bit Score: 333.824
Threshold Setting Gi: 2499783
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q59543 157 EFNNDIVWCFGADNDAMTYHCTISPIVGKAS 187 Methylophilus methylotrophus
P00372 156 EFGNDIIWCFGAEDDAMTYHCTISPIVGKAS 186 Methylobacterium extorquens AM1
P22619 158 EFANDIIWCFGAEDDAMTYHCTISPIVGKAS 188 Paracoccus denitrificans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap