2MTA


Conserved Protein Domain Family
TTQ_MADH_Hv

?
TIGR02658: TTQ_MADH_Hv 
Click on image for an interactive view with Cn3D
methylamine dehydrogenase (amicyanin) heavy chain
This family consists of the heavy chain of methylamine dehydrogenase light chain, a periplasmic enzyme. The enzyme contains a tryptophan tryptophylquinone (TTQ) prothetic group derived from two Trp residues in the light subunity. The enzyme forms a complex with the type I blue copper protein amicyanin and a cytochrome. Electron transfer procedes from TQQ to the copper and then to the heme group of the cytochrome. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 131706
View PSSM: TIGR02658
Aligned: 5 rows
Threshold Bit Score: 671.571
Threshold Setting Gi: 2499788
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2MTA_H  20 EPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVE 99  Paracoccus denitrificans
Q49124  58 DPVVLKAAPINARRVFVYDPKHFAAISQFYMIDGDTARVVGTADGGFLSNPVVASDGSFFGQASTVYERIARGKRTDYVE 137 Methylobacterium exto...
Q59542  54 ETSIAIAPASDSKRVYVLDPGNFHMTSTVYTIDGKSSKLLGMTDAGKLPNVMVASDGKFLAIANTMYSRVARGKRDDYLE 133 Methylophilus methylo...
Q50420  49 NITMEPGLPSDAKRVYVLDPGHFHVTTTVYTIDGNKNNLLGMTDTGKLANVMLSSDGKFFVTSNTTYSRIARGKRDDYVE 128 Methylobacillus flage...
P29894  64 EPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVE 143 Paracoccus denitrificans
2MTA_H 100 VFDPVTLLPTADIELPDApRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTF 179 Paracoccus denitrificans
Q49124 138 LLDPQTNNPIADIELPNSpRFLVGTYPWMTALTPNNKTLLFYQFSPQPAVGVVDLAGKKFDRMIEVPDCYHIFPSSNDTF 217 Methylobacterium exto...
Q59542 134 LIDTKTHQPIADIDIPEG-RFLTGVFERTAGLSVDDKHLLFQQFSPSPGVGLVDLQQKAFVKIMNVPDCYHIFPTANQNF 212 Methylophilus methylo...
Q50420 129 VIDAQSHKVLADIDIPEG-RFLTGVMNRMASLSTDNKYMLFQQFAPSPAVGLVDLEKKSFVKMMDIPDCYQIFPVPNQSF 207 Methylobacillus flage...
P29894 144 VFDPVTLLPTADIELPDApRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTF 223 Paracoccus denitrificans
2MTA_H 180 FMHCRDGSLAKVAFGTEGTPE-ITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEA 258 Paracoccus denitrificans
Q49124 218 FMHCRDGSLLKVGIGADGKSQ-TKRTEIFHKENEYLINHPAYSPKSGRLVWPTYTGKIFQIDLSSQDAKFLPAIEAFTDA 296 Methylobacterium exto...
Q59542 213 FMHCRDGSLMQFTYDSKGNTK-QKPTKIFHAEKEYLLNNPYYSNSNNHLTWPTYEGKIFQAKLSESGAEFLKPIEVFTDK 291 Methylophilus methylo...
Q50420 208 YMHCRDGSLQQFGYDDKGNLKpMKPTKVFHGEDDYLFVNPYYSNGSGRLVWPTYEGRIFQAKLTDKKVDFMKPFELFTEA 287 Methylobacillus flage...
P29894 224 FMHCRDGSLAKVAFGTEGTPE-ITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEA 302 Paracoccus denitrificans
2MTA_H 259 ERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFLVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALST 338 Paracoccus denitrificans
Q49124 297 EKKEGWAPGGWQQVAYHRESDRIFLLGDQRAASKHKAPSRFLFVIDAKTGKRINKIELKHEIDSVGVSQDAKPQLYALST 376 Methylobacterium exto...
Q59542 292 EKADKWRPGGWQTIAFHKARNELYLLADQREKWTHKLPSRFVFVVDATSGKRLRRIELKHEINSIAVSQDDKPYLYAVSE 371 Methylophilus methylo...
Q50420 288 EKKANWRPGGWQVVAYHKARNEIYVLADQRAKWTHVTASRYVFVVDGTTGKRLRRIDLGHEIDGISVTQDANPNLYAVSA 367 Methylobacillus flage...
P29894 303 ERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRLLVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALST 382 Paracoccus denitrificans
2MTA_H 339 GDKTLYIHDAESGEELRSVNQLGHGPQVITTAD 371 Paracoccus denitrificans
Q49124 377 GDKALYIFDPETGKEVSSVNQLGAGPQVVMTSD 409 Methylobacterium extorquens AM1
Q59542 372 EAKTLFTFDAVNGKALSSIDELGRAPSMIFIAD 404 Methylophilus methylotrophus
Q50420 368 EAKTLFTFNAVTGKETGKVDELGRAPTISLTMD 400 Methylobacillus flagellatus KT
P29894 383 GDKTLYIHDAESGEELRSVNQLGHGPQVITTAD 415 Paracoccus denitrificans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap