1TF7


Conserved Protein Domain Family
circ_KaiC

?
TIGR02655: circ_KaiC 
Click on image for an interactive view with Cn3D
circadian clock protein KaiC
Members of this family are the circadian clock protein KaiC, part of the kaiABC operon that controls circadian rhythm. It may be universal in Cyanobacteria. Each member has two copies of the KaiC domain (pfam06745), which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. [Cellular processes, Other]
Statistics
?
PSSM-Id: 131703
View PSSM: TIGR02655
Aligned: 5 rows
Threshold Bit Score: 1006.78
Threshold Setting Gi: 54036149
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TF7_A  19 AKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLV 98  Synechococcus sp.
Q8YT40  18 EKIRTMIEGFDDISHGGLPVGRTTLVSGTSGTGKTLLSLQFLFNGISFFDEPGVFVTFEESPSDIIKNAHIFGWNLQRLI 97  Nostoc sp. PCC 7120
Q79PF4  19 AKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLV 98  Synechococcus elongat...
Q6L8L1  20 TKILTRIEGFDDISHGGIPLGRTTLVSGTSGTGKTMFAIQFLYHGIVHFDDPAVFVTFEESPKDIIQNALSFGWDLQQLM 99  Acaryochloris marina ...
Q7U8R3  15 QKLPTGIEGFDDVCQGGLPIGRSTLISGTSGTGKTVFSLHFLHNGIKHFDEPGIFVTFEESPLDILRNAASFGWNLQEMV 94  Synechococcus sp. WH ...
1TF7_A  99 DEGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATT 178 Synechococcus sp.
Q8YT40  98 NEGKLFILDASPDPEGQDIVGNFDLSALIERLQYAIRKYKAKRVSIDSITAVFQQYEAVGVVRREIFRLVARLKQLNVTT 177 Nostoc sp. PCC 7120
Q79PF4  99 DEGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATT 178 Synechococcus elongat...
Q6L8L1 100 DDGKLFILDASPDPEGQDIAGEFDLSALIERIQYAISKYQAKRVGIDSVTAIFQQYDAATVVRREIFRLTARLKQIGVTT 179 Acaryochloris marina ...
Q7U8R3  95 EQDKLFILDASPDPDGQDVAGSFDLSGLIERINYAIRKYKAKRVAIDSITAVFQQYDAVFVVRREIFRLIARLKEIGVTT 174 Synechococcus sp. WH ...
1TF7_A 179 VMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAMRLTQRS 258 Synechococcus sp.
Q8YT40 178 IITTERSEEYGPVASFGVEEFVSDNVVIARNVLEGERRRRTIEILKLRGTTHMKGEYPFTITNDGVNIFPLGAMRLTQRS 257 Nostoc sp. PCC 7120
Q79PF4 179 VMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAMRLTQRS 258 Synechococcus elongat...
Q6L8L1 180 VMTTERVDEYGPVARYGVEEFVSDNVVIVRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDDGINIFPLGAMRLTQRS 259 Acaryochloris marina ...
Q7U8R3 175 VMTTERIDEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTVEILKLRGTTHMKGEFPFTMGTHGISIFPLGAMRLTQRS 254 Synechococcus sp. WH ...
1TF7_A 259 SNVRVSSGVVRLDEMCGGGFFKDSIILATGATGTGKTLLVSRFVENACANKERAILFAYEESRAQLLRNAYSWGMDFEEM 338 Synechococcus sp.
Q8YT40 258 SNVRVSSGVKTLDGMCGGGFFKDSIILATGATGTGKTLLVSKFLQNGCVNNERAILFAYEESRAQLSRNAYSWGIDFEEL 337 Nostoc sp. PCC 7120
Q79PF4 259 SNVRVSSGVVRLDEMCGGGFFKDSIILATGATGTGKTLLVSRFVENACANKERAILFAYEESRAQLLRNAYSWGMDFEEM 338 Synechococcus elongat...
Q6L8L1 260 SNARVSSGVQTLDEMCGGGFFKDSIILVTGATGTGKTLLVSKFLEDACKNGDRAILFAYEESRAQLSRNAYSWGIDFEEM 339 Acaryochloris marina ...
Q7U8R3 255 SNVRVSSGVPRLDEMCGGGFFKDSIILATGATGTGKTLLVSKFIEDACRNKERAILFAYEESRAQLLRNGTSWGIDFEQM 334 Synechococcus sp. WH ...
1TF7_A 339 ERQNLLKIVCAYPESAGLEDHLQIIKSEINDFKPARIAIDSLSALARGVSNNAFRQFVIGVTGYAKQEEITGLFTNTSDQ 418 Synechococcus sp.
Q8YT40 338 ESQGLLKIICTYPESTGLEDHLQIIKSEIAYFKPARIAIDSLSALARGVSNNAFRQFVIGVTGYAKQEEITGFFTNTTDQ 417 Nostoc sp. PCC 7120
Q79PF4 339 ERQNLLKIVCAYPESAGLEDHLQIIKSEINDFKPARIAIDSLSALARGVSNNAFRQFVIGVTGYAKQEEITGLFTNTSDQ 418 Synechococcus elongat...
Q6L8L1 340 EQKGLLKILCTYPESAGLEDHLQQIKSEIAEFKPSRISIDSLSALARGVSNNAFRQFVIGVTGFAKQEEITGFFTNTTDH 419 Acaryochloris marina ...
Q7U8R3 335 EQDGLLKIICAYPESTGLEDHLQIIKTDIGQFKPSRMAIDSLSALARGVSHNAFRQFVIGVTGYAKQEEIAGFFTNTSEE 414 Synechococcus sp. WH ...
1TF7_A 419 FMGAHSITDSHISTITDTIILLQYVEIRGEMSRAINVFKMRGSWHDKAIREFMISDKGPDIKDSFRNFERIISGSPTRIT 498 Synechococcus sp.
Q8YT40 418 FMGSHSITDSHISTITDTILMLQYVEIRGEMSRAINVFKMRGSWHDKGIREYNITADGPEIQDSFRNYERIVSGSPTRVS 497 Nostoc sp. PCC 7120
Q79PF4 419 FMGAHSITDSHISTITDTIILLQYVEIRGEMSRAINVFKMRGSWHDKAIREFMISDKGPDIKDSFRNFERIISGSPTRIT 498 Synechococcus elongat...
Q6L8L1 420 FLGSHSITESHISTITDTILMLQYVEILGEMSRAINVFKMRGSWHDKGIREYSISQHGPEIKNAFHNFEGIISGTPTRVS 499 Acaryochloris marina ...
Q7U8R3 415 FMGSHSITDSHISTITDTILMLQYVEIRGEMARALNVFKMRGSWHDKGIREFVITGNGPQIKDSFSNFERIISGVPHRVT 494 Synechococcus sp. WH ...
1TF7_A 499 VDEK 502 Synechococcus sp.
Q8YT40 498 IDEK 501 Nostoc sp. PCC 7120
Q79PF4 499 VDEK 502 Synechococcus elongatus PCC 7942
Q6L8L1 500 LDEK 503 Acaryochloris marina MBIC11017
Q7U8R3 495 TDER 498 Synechococcus sp. WH 8102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap