Conserved Protein Domain Family
TIGR02652

?
TIGR02652: TIGR02652 
TIGR02652 family protein
Members of this family of conserved hypothetical proteins are found, so far, only in the Cyanobacteria. Members are about 170 amino acids long and share a motif CxxCx(14)CxxH near the amino end. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131700
View PSSM: TIGR02652
Aligned: 4 rows
Threshold Bit Score: 287.5
Threshold Setting Gi: 499748627
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC09919       6 SHY-PIFGPEIRCPHCRQIIPALTLTDTYLCPRHGPFEADAKTGELMHLQSGRIWRLWEGEWYRQHTHPDGIRFEIHDAL 84  Thermosynechoco...
BAC90499       5 VNYnPIFGPEIRCPHCRQWVAALTLTDTYLCQRHGAFEADPETETLVHLQSGRRWRLWEDNWYRQHTHPDGIRFEIHEEL 84  Gloeobacter vio...
BAD80325       6 AQY-PLFGAEISCPHCRQNIPALTLTDAYLCNRHGAFEANPETGELVHLQSGRTWRRWEDQWHRQHTHPDGLRFEIHEAL 84  Synechococcus e...
WP_011429361   5 FSY-PIFGPSIQCPHCRQTIAALTLTDTYLCHRHGAFEADPEQEELVHLQSGRRWRLWEGRWYRQHTHADGIRFEIHEEL 83  Synechococcus s...
BAC09919      85 DRLYTQGYRATKVIIAERYRDLFCAYLERSTpwRGATDGQMLRLFGLPVEFS-----PPASQEERWDVINFDLEKEPGAP 159 Thermosynechoco...
BAC90499      85 DRLHTQGYRATRVVVAERYRELISTFLERTT--FGRSEDARHRLYGLPVEFS-----GAADQDGRWSVINFELVKEPGPP 157 Gloeobacter vio...
BAD80325      85 DRLFSQGQHAVRVTIADRYRELLRSYWQRSGg-LGAAACSEHRIYGLPVQFS-----PSPKEDPCGAVINFQLESKDGAL 158 Synechococcus e...
WP_011429361  84 DRLRMQGMRATQVIVAERYRSLLTPYLEQGS--QRRP--GPPRLYGLPVSFSsqlpeGAGGSPQRWRVINFELICELDPA 159 Synechococcus s...
BAC09919     160 IRPP--YFRMFD 169 Thermosynechococcus elongatus BP-1
BAC90499     158 LKYP--YFRLFD 167 Gloeobacter violaceus PCC 7421
BAD80325     159 LRYP--HFRLFE 168 Synechococcus elongatus PCC 6301
WP_011429361 160 MRQPqsRLQFCD 171 Synechococcus sp. JA-3-3Ab
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap