2CBN


Conserved Protein Domain Family
true_RNase_BN

?
TIGR02649: true_RNase_BN 
Click on image for an interactive view with Cn3D
ribonuclease BN
Members of this protein family are ribonuclease BN of Escherichia coli K-12 and closely related proteins believed to be equivalent in function. Note that E. coli appears to lack RNase Z per se, and this protein of E. coli appears orthologous to (but not functionally equivalent to) RNase Z of Bacillus subtilis and various other species. Meanwhile, the yihY gene product of E. coli previously was incorrectly identified as RNase BN. [Transcription, RNA processing]
Statistics
?
PSSM-Id: 131697
View PSSM: TIGR02649
Aligned: 3 rows
Threshold Bit Score: 627.814
Threshold Setting Gi: 41017525
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2CBN_A         4 LIFLGTSAGVPTRTRNVTAILLNLQHPTQSGLWLFDCGEGTQHQLLHTAFNPGKLDKIFISHLHGDHLFGLPGLLCSRSM 83  Escherichia coli
WP_000817396   9 LIFLGTSAGVPTRTRNVTAILLNLQHPTQSGLWLFDCGEGTQHQLLHTAFNPGKLDKIFISHLHGDHLFGLPGLLCSRSM 88  Enterobacteriaceae
P60195         3 LIFLGTSAGVPTRSRNVTAILLHLQHPTQPGVWLFDCGEGTQHQMLNTAFHPGKLERIFISHLHGDHLFGLPGLLCSRSM 82  Salmonella ente...
2CBN_A        84 SGIIQPLTIYGPQGIREFVETALRISGSWTDYPLEIVEIGAGEILDDGLRKVTAYPLEHPLECYGYRIEEHDAPGALNAQ 163 Escherichia coli
WP_000817396  89 SGIIQPLTIYGPQGIREFVETALRISGSWTDYPLEIVEIGAGEILDDGLRKVTAYPLEHPLECYGYRIEEHDKPGALNAQ 168 Enterobacteriaceae
P60195        83 AGNPHPLTVYGPQGVREFIATTLRLSGSWTDFPLQIEEISAGDILDDGLRKVTAFRLEHPLECYGYRVVEHDKPGALNAR 162 Salmonella ente...
2CBN_A       164 ALKAAGVPPGPLFQELKAGKTITLEDGRQINGADYLAAPVPGKALAIFGDTGPCDAALDLAKGVDVMVHEATLDITMEAK 243 Escherichia coli
WP_000817396 169 ALKAAGVPPGPLFQELKAGKTITLEDGRQINGADYLAAPVPGKALAIFGDTGPCDAALDLAKGVDVMVHEATLDITMEAK 248 Enterobacteriaceae
P60195       163 ALKAAGVTPGPLFQALKAGKTVTLADGRQINGADYLAPAVAGKSVAIFGDTAPCEAALALAQGVDVMVHETTLDASMEEK 242 Salmonella ente...
2CBN_A       244 ANSRGHSSTRQAATLAREAGVGKLIITHVSSRYDDKGCQHLLRECRSIFPATELANDFTVFNV 306 Escherichia coli
WP_000817396 249 ANSRGHSSTRQAATLAREAGVGKLIITHVSSRYDDKGCQHLLRECRSIFPATELANDFTVFNV 311 Enterobacteriaceae
P60195       243 ANARGHSSTRQTATLAREAAVGRLIMTHISSRYDDKGCQRLLAECRAIFPATELAYDFSVFPV 305 Salmonella enterica subsp. enter...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap