1AZY


Conserved Protein Domain Family
T_phosphoryl

?
TIGR02643: T_phosphoryl 
Click on image for an interactive view with Cn3D
thymidine phosphorylase
Thymidine phosphorylase (alternate name: pyrimidine phosphorylase), EC 2.4.2.4, is the designation for the enzyme of E. coli and other Proteobacteria involved in (deoxy)nucleotide degradation. It often occurs in an operon with a deoxyribose-phosphate aldolase, phosphopentomutase and a purine nucleoside phosphorylase. In many other lineages, the corresponding enzyme is designated pyrimidine-nucleoside phosphorylase (EC 2.4.2.2); the naming convention imposed by this model represents standard literature practice. [Purines, pyrimidines, nucleosides, and nucleotides, Other]
Statistics
?
PSSM-Id: 131691
View PSSM: TIGR02643
Aligned: 8 rows
Threshold Bit Score: 658.742
Threshold Setting Gi: 14023505
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1AZY_A           2 FLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLDWKslHLNGPI 81  Escherichia c...
BAB50111         1 MLPQEIIRHKRDGHRLSAGEIAAFIGGVTSGAVTDGQAAAFAMAVFFNGMNRDEAVALTLAMRDSGDVLDWS--DLPGPV 78  Mesorhizobium...
P07650           2 FLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLDWKslHLNGPI 81  Escherichia c...
AAQ61362         2 FLPQEIIRKKRDNLTLSQQEIQQFVAGITDNSVADSQIAALAMAIYFNGMELEENVHLALAMRDSGRRMHWKdlNLPGPI 81  Chromobacteri...
tigr:BMAA0114    3 FLPQEFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAMAVYFNELPLSARIALTLAQRDSGDVLDWRgaRLNGPV 82  Burkholderia ...
uhmanoa:IL1882   2 FLAQEVIRKKRDAVSLSDTDIQQFVNGICDDSVSEGQIAALAMAIYFRGMSAQEKTALTVAMRDSGDVLDWRqdNLNGPV 81  Idiomarina lo...
WP_010968373     3 MLPQEIIRKKRDGDRLDPAEIAGFIAGVTDGSVSEGQAAAFAMAVWFSGMNRDECVALTLAMRDSGETLDWS--DLARPI 80  Sinorhizobium...
WP_010970672     3 LIPQEIIRRKRDGLSLAPQEIAAFIEALSKDGISEGQAAAFAMAVFFRGMNRDEMVALTLAMRDSGDVLSWR--DIGRPV 80  Agrobacterium...
1AZY_A          82 VDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLA 161 Escherichia c...
BAB50111        79 TDKHSTGGVGDNVSLMLAPIVAACGAYVPMISGRGLGHTGGTLDKMDAIPGYISQPDIALFRQAVLETGCAIIGQTADLA 158 Mesorhizobium...
P07650          82 VDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLA 161 Escherichia c...
AAQ61362        82 VDKHSTGGVGDVVSLMLGPMVAACGGFVPMISGRGLGHTGGTLDKLSAVPGYNPFPEPELFRKVVKDVGVAIIGQTSDLA 161 Chromobacteri...
tigr:BMAA0114   83 VDKHSTGGVGDLTSLVIGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGYDVAPSVDMLRRVVRDAGLAIVGQTAQLA 162 Burkholderia ...
uhmanoa:IL1882  82 LDKHSTGGVGDVVSLMLGPIVAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTAPDNRRFRDTVKQAGVAIIGQTGRLA 161 Idiomarina lo...
WP_010968373    81 VDKHSTGGVGDNVSLMLAPIVAACGAAVPMISGRGLGHTGGTLDKLESIPGYDIQPSPELFRRVADEVGCAIIGQTADLA 160 Sinorhizobium...
WP_010970672    81 ADKHSTGGVGDNVSLMLAPIVAACGLAVPMISGRGLGHTGGTLDKLEAIPGYDVMPDEALFRRTVQSVGCAIIGQTGDLA 160 Agrobacterium...
1AZY_A         162 PADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLTD 241 Escherichia c...
BAB50111       159 PADRRLYAIRDVTGTVESVPLITASILSKKLAAGLGSLVLDVKVGNGAFMERSRDATALANSLVEVASGAGLKVSALITG 238 Mesorhizobium...
P07650         162 PADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLTD 241 Escherichia c...
AAQ61362       162 PADRRFYATRDVTATVESIALITASILSKKLAAGLDVLVMDVKAGSGAFMPTMQKSIELAERIVKVGNGAGVATTALITE 241 Chromobacteri...
tigr:BMAA0114  163 PADKRIYAVRDVTATVESISLITASILSKKLAAGVGALAMDVKVGSGAFMPSAEQSAELARSIVDVGNGAGMRTAATLTD 242 Burkholderia ...
uhmanoa:IL1882 162 PADSRFYATRDVTATVESIPLITASILAKKLAEGLDGLVMDVKAGNGAFMPGYDESRELAQSLVSVGRKLGVETTALITD 241 Idiomarina lo...
WP_010968373   161 PADKRLYAIRDVTATVDSVPLITASILSKKLAAGLRSLVLDVKLGNGSFMTDPAETEVLARSLVEVANGAGVRTSALITD 240 Sinorhizobium...
WP_010970672   161 PADKRLYAIRDVTATVDSIPLITASILSKKLAAGLETLVLDVKVGNGAFMQSLEDARILARALVDVANGAGLPTTALITD 240 Agrobacterium...
1AZY_A         242 MNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDDAEARAKLQAVLDNGKAAEVFGRMVAAQK 321 Escherichia c...
BAB50111       239 MNEPLASAAGNAVEVHNAVDFLTGRLRDRRLEDVTLALAAEMLQSTGLVSSNQDGLRRATETLTSGRAAATFARMVAVLG 318 Mesorhizobium...
P07650         242 MNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDDAEARAKLQAVLDNGKAAEVFGRMVAAQK 321 Escherichia c...
AAQ61362       242 MSQPLASTAGNSIETREAVRYLKGDQRNPRLHEVTMALCAQMLIGGKLAADEADARAKLQAALDSGRAAEIFGRMVTALG 321 Chromobacteri...
tigr:BMAA0114  243 MNQALAPCAGNAIEVRCAIDFLTGAARPARLEAVSFALAAQMLTMGGLAADAHDARRRLRAVLESGAAAERFARMVAALG 322 Burkholderia ...
uhmanoa:IL1882 242 MNQALGSAAGNAVEVQLAVDYLTGKRRDKRLHQVTKALSAELLVSGNLAKSTDQAEVMVENVLGSGLAAERFAKMVGSLG 321 Idiomarina lo...
WP_010968373   241 MNEPLADAAGNALEIENCLAYLRGEKAGTRLDQVVMALAAEMLVAAGIAAHEAEAEAMARRVLGSGEAMERFGLMVHRLG 320 Sinorhizobium...
WP_010970672   241 MNQPLCDAAGNAVEIVNCLEFLAGGKAGTRLEKVVLSFAAEMLVQARKAATLEEGEALASAALSSGRAMEIFARMVSVLG 320 Agrobacterium...
1AZY_A         322 GPTDFVENYAKYLPTAMLTKAVYADTEG---FVSEMDTRALGMAVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQRP 398 Escherichia c...
BAB50111       319 GPADFIEKPEKYLAVAPTEFAVRATTDG---FVTGIATRDIGLAVVGLGGGRTRPDDKIDPSVGITRLLPIGAEVHAGDA 395 Mesorhizobium...
P07650         322 GPTDFVENYAKYLPTAMLTKAVYADTEG---FVSEMDTRALGMAVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQRP 398 Escherichia c...
AAQ61362       322 GPADFMEHYDRHLAPAPIMRPVYADRAG---YVGAMDTRGIGMAVCALGGGRRLATDVLDFRVGLSQFVELGQNIGKDTP 398 Chromobacteri...
tigr:BMAA0114  323 GPADLVERPERHLPRAAAAAPVAAARAG---WIERIDARALGLAVVGLGGGRAKIGDTLDYSVGLSALAELGERVEAGQP 399 Burkholderia ...
uhmanoa:IL1882 322 GPHDFLEKSDQYLPQANLRKPLKLPAEYhglYLSEVNTRELGMAVVCLGGGRRKADDKLDLSVGMTDILTVGSKVDSESV 401 Idiomarina lo...
WP_010968373   321 GPADFVDRPGAYLAKAPAILAVPAGRHG---YLTSCKTRELGMAVIELGGGRIRPDDRIDHRVGLTGLRPLGTKVEKGEP 397 Sinorhizobium...
WP_010970672   321 GPSDFIENPSRYLACAPIILPVPAARSG---WLASCATRDLGMVVVELGGGRTKPSDTINPAVGISDILPLGVRVEKGEP 397 Agrobacterium...
1AZY_A         399 LAVIHAKDENNWQEAAKAVKAAIKLADKAPESTPTVYRRI 438 Escherichia coli K-12
BAB50111       396 LALVHARSPADAEAAAATVVSAYAIGASKPAADKTVMRRI 435 Mesorhizobium loti MAFF303099
P07650         399 LAVIHAKDENNWQEAAKAVKAAIKLADKAPESTPTVYRRI 438 Escherichia coli K-12
AAQ61362       399 LMMIHAADEASFEDAARRVKAAIRIDEAAPSELPLVYQII 438 Chromobacterium violaceum ATCC 12472
tigr:BMAA0114  400 LATVHARDADSAAQATDAVRRAYRIGAEPPAQTRVVHAVI 439 Burkholderia mallei ATCC 23344
uhmanoa:IL1882 402 IATVHASNESDWQEAADSILKALSFSSTPPEPDSVIYERI 441 Idiomarina loihiensis L2TR
WP_010968373   398 IAFVHAADQSQAEAIAKRVVTLYAIADEEPARRPVIVSKL 437 Sinorhizobium meliloti
WP_010970672   398 IAVVHAASSEDAERAVKRIEDCFGIADNAPEIAASVLERI 437 Agrobacterium fabrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap