Conserved Protein Domain Family
gas_vesic_GvpN

?
TIGR02640: gas_vesic_GvpN 
gas vesicle protein GvpN
Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728). [Cellular processes, Other]
Statistics
?
PSSM-Id: 131688
View PSSM: TIGR02640
Aligned: 5 rows
Threshold Bit Score: 435.76
Threshold Setting Gi: 12230149
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC38414  15 FIQDDETKEVLSRALSYLKSGYSIHFTGPAGGGKTSLARALAKKRKRPVMLMHGNHELNNKDLIGDFTGYTSKKVIDQYV 94  Bacillus megaterium
P55150    20 FVVTPAIERVAIRALRYLKSGFPVHLRGPAGTGKTTLAMHLANCLDRPVMLLFGDDQFKSSDLIGSESGYTHKKVLDNYI 99  Dolichospermum flos...
Q9RH29    45 FVETEQVRDLTRRGLGFLNAGYPLHFRGPAGTGKTTLALHVAAQLGRPVIIITGDNELGTADLVGSQRGYHYRKVVDQFI 124 Ancylobacter aquaticus
Q9HI16    64 FIETESVNRVESRMERWLDVGRPVHLIGPTGCGKTSLAMHVARERDRPVVWINGDAELTTSDLVGEYAEKERISEHDQFI 143 Halobacterium sp. N...
Q9HHS9    62 FIETDAVARVTDRMRRWLSVDRPVHLIGPTGCGKTAVAMHVARTRDRPVVWVNGDADLTTSDLVGEYAETERISEHDQFI 141 Halobacterium sp. N...
AAC38414  95 RSVYKKDEQVSENWQDGRLLEAVKNGYTLIYDEFTRSKPATNNIFLSILEEGVLPLYGVKMTDPFVRVHPDFRVIFTSNP 174 Bacillus megaterium
P55150   100 HSVVKLEDEFKQNWVDSRLTLACREGFTLVYDEFNRSRPEVNNVLLSALEEKILSLPPSSNQPEYLSVNPQFRVIFTSNP 179 Dolichospermum flos...
Q9RH29   125 HNVTKLEETANQHWTDHRLTTACREGFTLVYDEFTRSRPETHNVLLGVFEERMLFLPAQAREECYIKVHPEFRAIFTSNP 204 Ancylobacter aquaticus
Q9HI16   144 HNVVKSKDIIRDRWVDNPLTLAVQEGATLVYNEFSRTKPVANNVLLSVFEEGVLELPGKRGKSRYVDVHPEFRTILTSNS 223 Halobacterium sp. N...
Q9HHS9   142 HNVVKRKDIVRDRWVDNPLTLAVQEGATLVYNEFSRTKPVANNVLLSVFEEGVLELPGKRGASRYVDVHPAFRTILTSNS 221 Halobacterium sp. N...
AAC38414 175 AEYAGVYDTQDALLDRLITMFIDYKDIDRETAILTEKTDV-EEDEARTIVTLVANVRnRSGDENSSGlsLRASLMIATLA 253 Bacillus megaterium
P55150   180 EEYAGVHSTQDALMDRLVTISMPEPDEITQTEILIQKTNI-DRESANFIVRLVKSFRlATGAEKTSG--LRSCLMIAKVC 256 Dolichospermum flos...
Q9RH29   205 QEYAGVHASQDALADRLATIDVDYPDRAMELAVASARTGM-AEASAARIIDLVRAFR-ASGDYQQTPt-MRASLMIARVA 281 Ancylobacter aquaticus
Q9HI16   224 VEYAGVHEPQDALLDRLIGIYMDFYDLDTEIEIVRAHVDKsADTNVEDIVRVLRELR--ERLDITVG--TRAAIMANEGA 299 Halobacterium sp. N...
Q9HHS9   222 VEYAGVHEPQDALLDRLVGLHMDFYDAETETAIVRAHVEA-ADVPVAAIVGMMRELR--ERLEITVG--TRAAIMAAEGL 296 Halobacterium sp. N...
AAC38414 254 TQQDIPIDGSDEDFQTLCIDILHHPL 279 Bacillus megaterium
P55150   257 ADNNIPVTTESLDFPDIAIDILFNRS 282 Dolichospermum flos-aquae
Q9RH29   282 ALEGLDVSVDDPRFVQLCSDALESRI 307 Ancylobacter aquaticus
Q9HI16   300 TTVD---TVDQAVLTDICTDVLASKV 322 Halobacterium sp. NRC-1
Q9HHS9   297 TAAD---DPDADTVVDVCTDVLASKV 319 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap