2BI4


Conserved Protein Domain Family
lactal_redase

?
TIGR02638: lactal_redase 
Click on image for an interactive view with Cn3D
lactaldehyde reductase
This clade of genes encoding iron-containing alcohol dehydrogenase (pfam00465) proteins is generally found in apparent operons for the catabolism of rhamnose or fucose. Catabolism of both of these monosaccharides results in lactaldehyde which is reduced by this enzyme to 1,2 propanediol. This protein is alternatively known by the name 1,2 propanediol oxidoreductase. This enzyme is active under anaerobic conditions in E. coli while being inactivated by reactive oxygen species under aerobic conditions. Under aerobic conditions the lactaldehyde product of rhamnose and fucose catabolism is believed to be oxidized to lactate by a separate enzyme, lactaldehyde dehydrogenase. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 131686
View PSSM: TIGR02638
Aligned: 9 rows
Threshold Bit Score: 614.06
Threshold Setting Gi: 445931400
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BI4_A        12 ANRMILNETAWFGRGAVGALTDEVKRRGYQKALIVTDKTLVQCGVVAKVTDKMDAAGLAWAIYDGVVPNPTITVVKEGLG 91  Escherichia coli
P11549         3 ANRMILNETAWFGRGAVGALTDEVKRRGYQKALIVTDKTLVQCGVVAKVTDKMDAAGLAWAIYDGVVPNPTITVVKEGLG 82  Escherichia coli
AAU38932       2 SNRFILNETAYFGAGSIQHIVTEVQKRGFTKGLIVTDKSLIQFKVVEKVTALLEGANLAYEIFDEVLPNPTMNVVKAGLA 81  Mannheimia succ...
AAQ63048       2 SNRLILNETSYHGKGAIQHIVYEVKSRSFKKALVVTDKDLIKYNVASKVTDLLDTAGLPYEIFDEVKANPSVDVIKAGVE 81  Actinobacillus ...
BAD47003       2 INRFILNEVSYFGPGAREVLPKEISRLGLHKAFVATDKDLIKFGVADKVLKVLEAAKIPYEIFSEIKPNPTVSNVKAGVE 81  Bacteroides fra...
BAC94939       2 AFALNLPKLSYSGVGAVDDAIATLSQQPIKRALVVTDHNLVELGILDHLFELLDEFSIDYELFDKVTPNPTATLVREGLA 81  Vibrio vulnific...
AAO78872       1 MNRIILNETSYFGAGCRSVIAVEAARRGFKKAFFVTDKDLIKFGVAAEIIKVFDDNHIPYELYSDVKANPTIANVQNGVA 80  Bacteroides the...
WP_002288246   2 SNRMILNETSYFGKGAIESIVPEFQQRGFGKAAVITDKGLIEHGIATKVTELLDKAAIAYALYDGIVPNPTIQNVKDGVA 81  Enterococcus fa...
WP_000009255   2 SFMLALPKISLHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDEHQMSYHLFDEVFPNPTEELVQKGFA 81  Salmonella ente...
2BI4_A        92 VFQNSGADYLIAIGGGSPQDTCKAIGIISNNPEFADVRSLEGLSPTNKPSVPILAIPTTAGTAAEVTINYVITDEEKRRK 171 Escherichia coli
P11549        83 VFQNSGADYLIAIGGGSPQDTCKAIGIISNNPEFADVRSLEGLSPTNKPSVPILAIPTTAGTAAEVTINYVITDEEKRRK 162 Escherichia coli
AAU38932      82 KFKASGADYMIAIGGGSPQDTAKAIGIIVNNPEFADIRSLEGTAPTKKPAVPTIAVPTTAGTAAEVTINYVITDEENKRK 161 Mannheimia succ...
AAQ63048      82 KFKASGPNYLIAIGGGSPMDSAKAIGIIINNPEFNHGGSLQGVAPTHQKCIPIIAAPTTVGTAAEVTINYVITDEEKKRK 161 Actinobacillus ...
BAD47003      82 AFASSGADFILAIGGGSSMDTAKAIGIISNNPEFSDVVSLEGVADTKKKSVPIIALPTTAGTAAEVTINYVITDEQNQKK 161 Bacteroides fra...
BAC94939      82 VYNDTGCDCFIAVGGGSPVDCAKAIRIVASNP--GDIVDFDGVGKVKSAGDFFIAINTTAGTAAEMTSNSVITDESRQVK 159 Vibrio vulnific...
AAO78872      81 AYKASGADFIVALGGGSSIDTAKGIGIVVNNPDFADVKSLEGVADTKHKAVPTFALPTTAGTAAEVTINYVIIDEDARKK 160 Bacteroides the...
WP_002288246  82 FVKEAEADCLIAIGGGSPIDTAKAIGIILTNPEFSDVISLEGVADTKNPCLPILAIPTTSGTAAEVTINYVITDEVNHRK 161 Enterococcus fa...
WP_000009255  82 AYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYS--GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVK 159 Salmonella ente...
2BI4_A       172 FVCVDPHDIPQVAFIDADMMDGMPPALKAATGVDALTHAIEGYITRGAWALTDALHIKAIEIIAGALRGSVAG--DKDAG 249 Escherichia coli
P11549       163 FVCVDPHDIPQVAFIDADMMDGMPPALKAATGVDALTHAIEGYITRGAWALTDALHIKAIEIIAGALRGSVAG--DKDAG 240 Escherichia coli
AAU38932     162 FVCVDPHSIPVVAVIDSEMMASMPPTLKAATGVDALTHAIEGFITLGAWELSDMFHLKAIEIIARALRSSVKG--EQQGV 239 Mannheimia succ...
AAQ63048     162 FVCVDVHDVPAVAVVDPNMMSSMPKGLTAATGMDALTHAIEGYITKAAWELTDALHLKAIEIIARSLRSAVEN--DPQGR 239 Actinobacillus ...
BAD47003     162 MVCVDPNDIPSIAIVDAELMYTLPKSLTAATGLDALTHAIEGLITKGAWEMSDMFEIKAIEMINRYLVTAVEEpsNAEAR 241 Bacteroides fra...
BAC94939     160 MVIIDAKQIPDVAVNDPTLMVNLPPHVTAATGMDALTHAVEAYVTPGAHTLTKPTALEAIKLIAQWLPIAVEDgkNLEAR 239 Vibrio vulnific...
AAO78872     161 MVCVDPNDIPAVAIVDPELMYSMPKGLTAATGMDALTHAIESYITPGAWAMSDMFELKAIEMIAQNLKAAVDNgkDTVAR 240 Bacteroides the...
WP_002288246 162 FVCVDPHDIPIVAFIDSDMMMGMPKKLAASTGMDAMTHAIEGFITKGAWEMTDMLHLKAIEIIGHSLEVSVDG--DQNGR 239 Enterococcus fa...
WP_000009255 160 EVIIDPNIIPDIAVDDASVMLEIPASVTAATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINVWLPKAVDDghNLEAR 239 Salmonella ente...
2BI4_A       250 EEMALGQYVAGMGFSNVGLGLVHGMAHPLGAFYNTPHGVANAILLPHVMRYNAD-FTGEKYRDIARVMGVK-VEGMSLEE 327 Escherichia coli
P11549       241 EEMALGQYVAGMGFSNVGLGLVHGMAHPLGAFYNTPHGVANAILLPHVMRYNAD-FTGEKYRDIARVMGVK-VEGMSLEE 318 Escherichia coli
AAU38932     240 EDMALGQYVAGMGFSNVGLGLVHGMAHPLGAFYSTPHGVANAVLLPHIMAYNAD-FTGDKFRSIAKAMGVRnTEILSIEQ 318 Mannheimia succ...
AAQ63048     240 EGMALGQYVAGMGFSNVGLGVVHGMAHPLSAYYDTPHGIANAVLLPYVMEFNKN-HTGEKYREIARAMGVKgVNEMMQAE 318 Actinobacillus ...
BAD47003     242 NGMAVAQYIAGMAFSNVGLGVVHGMAHPLGAIFDIPHGVANALLLPIIMEFNAP-AALDKYVEIAKAMNVY-STDMTKEK 319 Bacteroides fra...
BAC94939     240 EQLANAQFLAGMAFNSAGLGLVHAMAHQPGATHNLPHGVCNAILLPQVCEFNAE-KYPQRFRDIASVMGGK-TEGLSDRE 317 Vibrio vulnific...
AAO78872     241 EAMSQAQYIAGMGFSNVGLGIVHSMAHPLGAFYDTPHGVANALLLPYVMEYNAEsPAAPKYIHIAKAMGVN-TDGMTETE 319 Bacteroides the...
WP_002288246 240 EKMALGQYIAGMGFSNVGLGLVHGMAHPLSAWYNIPHGVACAALLPTVMKYNKE-YTGEKYREIALVLGIKgAAEMSLED 318 Enterococcus fa...
WP_000009255 240 EQMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRP-NAVARFARIAQAMGVE-TRGMSDEV 317 Salmonella ente...
2BI4_A       328 ARNAAVEAVFALNRDVGIPPHLRDVGVRKEDIPALAQAALDDVCTGGNPREATLEDIVELY 388 Escherichia coli
P11549       319 ARNAAVEAVFALNRDVGIPPHLRDVGVRKEDIPALAQAALDDVCTGGNPREATLEDIVELY 379 Escherichia coli
AAU38932     319 ARVAAVEAVKTLNKDVGIPATLREVGMKEEDIPELAKAAFADVCTGGNPRPTSVNEIERLY 379 Mannheimia succiniciproducens MBEL55E
AAQ63048     319 YRDAAVAAVKQLAIDVGIPEKLSQIGVKEEDMPALSIDAFNKVCTPGNPRECTSQNILGVF 379 Actinobacillus pleuropneumoniae se...
BAD47003     320 AAEAAVEAVKTLSLRVNIPQHLSDLGIQESDLDRLATAAFADVCTPGNPREVTKEIILDLY 380 Bacteroides fragilis YCH46
BAC94939     318 AADLAVNLMRNLSKRVNIPSGFSLLGISRADCELWIEKALADPCLGGNPRQPTASEVESLY 378 Vibrio vulnificus YJ016
AAO78872     320 GVKAAIEAVKALSLSIGIPQKLHEINVKEEDIPALAVAAFNDVCTGGNPRPTSVAEIEVLY 380 Bacteroides thetaiotaomicron VPI-5482
WP_002288246 319 VREAACGEIDRLSKAVGIPETISELGVKEADIPAIAEDALRDVCTPGNPRETTVEEIIALY 379 Enterococcus faecium
WP_000009255 318 ASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALADPCAPCNPRTASRDEVRELY 378 Salmonella enterica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap