Conserved Protein Domain Family
RhaS

?
TIGR02637: RhaS 
rhamnose ABC transporter, rhamnose-binding protein
This sugar-binding component of ABC transporter complexes is found in rhamnose catabolism operon contexts. Mutation of this gene in Rhizobium leguminosarum abolishes rhamnose transport and prevents growth on rhamnose as a carbon source.
Statistics
?
PSSM-Id: 131685
View PSSM: TIGR02637
Aligned: 4 rows
Threshold Bit Score: 480.897
Threshold Setting Gi: 14025504
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB66208      59 VGFLPKQVNNPYFTVADKGGEKALKELGSSYKEVGTSSGTDTAGQVSYVNTLTQQQVDAIAVSAQDPGALCTALKQAMKN 138 Streptomyces co...
BAB52104      29 IALVVKSLGNGFFDAANKGAEEAAKELGDVDIIYTGPTKATAEAQIEVVNSLIAQKVNAIAISANDADALVPVLKKAMER 108 Mesorhizobium l...
WP_012547895  28 IGLVTKTAGNPFFEAVNKGAQEAAKELG-ITVIHQAPAASSVQGQIDIINSMIAQKVSAICISANDPDALVPACRKAQLR 106 Dictyoglomus th...
WP_010973083  34 IALVVKSLGNGFFEAANKGAQEAAKDLGGVEIIYTGPTSTTAEGQIEVINSLIAQGVDAIAISANDPDAVVPALKKAAQR 113 Agrobacterium f...
CAB66208     139 DIKVVTYDSDTNPECRNAFISQASADDIGRTQVQQMAEQIGNK-GEIAILSAAQTATNQNAWIEIMKDELKDPkYKDVKL 217 Streptomyces co...
BAB52104     109 GITVISWDSGVAKEGRQLHLNPSDTGLIGETIIKLAADYLPEG-GDVAILSASSTATNQNAWIDAAKKVLPEK-FPKIKL 186 Mesorhizobium l...
WP_012547895 107 GIPVVTFDSAVKPQGRKLFVNQADMEQIGRIQVQLLAKMINYE-GEIAILSAASTMANQNTWIAWMKEELKKPeYSKMKL 185 Dictyoglomus th...
WP_010973083 114 GIKVISWDSGVAPEGRILQLNPSSNALIGKMCLQLAAAHLEGGkGDFAILSATTTSTNQNVWIGEMKKQLKD--FPGLNL 191 Agrobacterium f...
CAB66208     218 VKVAYGDDDAQKSFQQTQGLLQEHPNLKGIISPTTVGIKAAAQYLSGSKYKGKVKLTGLGTPNDMRKYVKNGTVEAFELW 297 Streptomyces co...
BAB52104     187 VATVYGDDDSAKSTDEAKGLLKSYPNLKAIIAPTTVGVVAAAQVVTDEKLIGKVNVTGLALPSEFKKFIDNGASQAVALW 266 Mesorhizobium l...
WP_012547895 186 VAIVYGDDIREKSYNEAMGLFKSYPNLKGIIAPTTVGIAAAARAIEDAGLSGKVQLTGLGLPSEMAEYVKRGTCKAFALW 265 Dictyoglomus th...
WP_010973083 192 VTTVYGDDLADKSYREAQGLLSSQPNVKVIVAPTTVGVLAASQAVKDAGKIGQVFVTGLGLPSEMAGAIKSGATKEFAIW 271 Agrobacterium f...
CAB66208     298 DPAKLGELAARTAVALSSGQITGKEGETFKAGAMGEYTIGKNGVI----DLGKPTVFTADNVDQFDF 360 Streptomyces coelicolor A3(2)
BAB52104     267 NPIDLGYSAVYLAHDLAVKKEEAKPGATLSIGRVGKVTLDDSNSA----AMAPPFQFDKTNIEKFSK 329 Mesorhizobium loti MAFF303099
WP_012547895 266 NPIDLGYATIYATYRLLTREIKGNVGEKVNLGKLGERTIVDEGNGgrmiILGPPFVFDASNIDYWSK 332 Dictyoglomus thermophilum
WP_010973083 272 NPIDLGYSATQIAYRLVKGEADGKPGSEIEAGRMGKIKVGENSEA----AMADPFIYDAKNIDQFSK 334 Agrobacterium fabrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap