Conserved Protein Domain Family
xylG

?
TIGR02633: xylG 
D-xylose ABC transporter, ATP-binding protein
Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005). [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 131681
View PSSM: TIGR02633
Aligned: 4 rows
Threshold Bit Score: 916.137
Threshold Setting Gi: 1175040
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45046         3 LLEMKHITKKFGDVTALHNISIELEAGEILSLCGENGSGKSTLMKILCGIYPCGDYSGDIYFSESELKARNIRDTEEKGI 82  Haemophilus inf...
P37388         4 LLEMKNITKTFGSVKAIDNVCLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEIIFAGEEIQASHIRDTERKGI 83  Escherichia col...
WP_011333727   5 LLQMNGIVKTFGGVKALNGIDLKVRPGECVGLCGENGAGKSTLMKILSAVYPHGTWDGEILWDGQPLKAQSISETEAAGI 84  Pseudomonas flu...
WP_009910692   5 LLTMRGIVKDFDGVKALDGIDLTVRPGECVGLCGENGAGKSTLMKVLSGVHPHGTWDGEIHWEGAPLVASGVRDTERAGI 84  Burkholderia th...
P45046        83 SIIHQELTLVKNMSVLENIFLGNEITHKG-LTADNEMYLRCKNLLQQVQLDADPNTR-VGELGLGQQQLVEIAKALNKQV 160 Haemophilus inf...
P37388        84 AIIHQELALVKELTVLENIFLGNEITHNG-IMDYDLMTLRCQKLLAQVSLSISPDTR-VGDLGLGQQQLVEIAKALNKQV 161 Escherichia col...
WP_011333727  85 VIIHQELTLVPDLSVAENIFMGHELTLPGgRMNYPAMIHRAEALMRELKVPDMNVSLpVSQYGGGYQQLVEIAKALNKQA 164 Pseudomonas flu...
WP_009910692  85 VIIHQELMLVPELSVAENIFLGNEITLPGgRMHYAAMVRRAHELLRELRIDAINVARpVMDYGGGHQQLIEIAKALNKRA 164 Burkholderia th...
P45046       161 RLLILDEPTASLTEKETEILLNLIKDLKAHNIACIYISHKLNEVKAISDKICVIRDGEHVGTKDASTMTEDDIITMMVGR 240 Haemophilus inf...
P37388       162 RLLILDEPTASLTEQETSILLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSEDDIITMMVGR 241 Escherichia col...
WP_011333727 165 RLLILDEPSSALTRSEIEVLLDIIRDLKAKGVACVYISHKLDEVAAVCDTISVIRDGQHIATTAMENMDIPQIITQMVGR 244 Pseudomonas flu...
WP_009910692 165 KLLILDEPSSSLTAAETQGLLDIVRDLKRRGVACVYISHKLEEVEAVCDTVTVIRDGRHVATEPMRALSTERIIAMMVGR 244 Burkholderia th...
P45046       241 EITSLYPHEPHEIKDEILRVENLSAWHPINTHIKRVDNVSFSLHEGEILGVAGLVGSGRTDMVQCLFGSYEGKFEGNIFI 320 Haemophilus inf...
P37388       242 ELTALYPNEPHTTGDEILRIEHLTAWHPVNRHIKRVNDVSFSLKRGEILGIAGLVGAGRTETIQCLFGVWPGQWEGKIYI 321 Escherichia col...
WP_011333727 245 EMSSLYPTEPHDIGEVIFEARHITCYDVDNPKRKRVDDVSFSLRRGEILGIAGLVGAGRTELVTALFGAYPGRHEGEVWL 324 Pseudomonas flu...
WP_009910692 245 EIRNLYPREPHEIGDVVLEARNVTCHDVTNPRRKRVDDVSFSVRRGEILGVAGLVGAGRTELMQAIFGAYPGACAASVLM 324 Burkholderia th...
P45046       321 NQKQVNIKNCAQAIEHKIVMVPEDRKKHGIVSIMGVGKNITLSSLKSYCFgKMVVNEAKEEQIIGSAIKRLKVKTFSPDL 400 Haemophilus inf...
P37388       322 DGKQVDIRNCQQAIAQGIAMVPEDRKRDGIVPVMAVGKNITLAALNKFTGgISQLDDAAEQKCILESIQQLKVKTSSPDL 401 Escherichia col...
WP_011333727 325 DGHPIDTRTPLKSIRAGVCLVPEDRKRQGIIPDLGVGQNITLAVLDSFSK-LTRIDAEAELGSIDREISRLHLKTASPFL 403 Pseudomonas flu...
WP_009910692 325 NGRPLAIRSPADAIRAGIAMVPEDRKRHGIVPQLGVGHNITLSVLQRFAT-RGRIDAAAELDAIRAGMQRLSVRAAHPFL 403 Burkholderia th...
P45046       401 PIGRLSGGNQQKAILAKCLSLNPKILILDEPTRGIDVGAKYEIYKLINQLAQEGIAIIVISSELPEVLGISDRVLVMHQG 480 Haemophilus inf...
P37388       402 AIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGAKYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHEG 481 Escherichia col...
WP_011333727 404 PITSLSGGNQQKAVLAKMLLTRPRVLILDEPTRGVDVGAKYEIYKLMGMLAAEGVSIIMVSSELAEVLGVSDRVLVIGEG 483 Pseudomonas flu...
WP_009910692 404 PIAGLSGGNQQKAVLTKMLLTDPQVLILDEPTRGVDVGAKAEIYRLVFALARRGVALVVVSSELAEVLGLADRVLVIGEG 483 Burkholderia th...
P45046       481 KLKASLINTALTQEQVMETAL 501 Haemophilus influenzae Rd KW20
P37388       482 KLKANLINHNLTQEQVMEAAL 502 Escherichia coli K-12
WP_011333727 484 RLQGDFVNHELTQEQVLAAAL 504 Pseudomonas fluorescens
WP_009910692 484 EVCGDFVNDGLTQEQILAAAL 504 Burkholderia thailandensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap