Conserved Protein Domain Family
RhaD_aldol-ADH

?
TIGR02632: RhaD_aldol-ADH 
rhamnulose-1-phosphate aldolase/alcohol dehydrogenase
Statistics
?
PSSM-Id: 131680
View PSSM: TIGR02632
Aligned: 4 rows
Threshold Bit Score: 1097.98
Threshold Setting Gi: 499337662
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAQ92405      23 PGKLLYRSNLLGADKRITNYGGGNTSAKVMETDpLTGGKVKVLWVKGSGGDVGTIRLDGFATLYQDKLESLKSIY----- 97  Rhizobium legum...
BAD62917      18 LDELVYRSNLIGADRSVCNWGGGNTSMKTTEID-FRGNEVDVMWVKGSGSDLATMGANNFTGLRLDDVLPLKERE----- 91  Bacillus clausi...
WP_012258146  26 VARLVYRSNLLGSDQRITNTGGGNTSAKITERDpLTAAPVEVLWVKGSGGDLRTSTRANFASLELRKLRELRTMYlrdpa 105 Chloroflexus
WP_011027370   7 AAALLARSHRLGADPRNTNYAGGNASAKGTGTDpVTGGEVELMWVKGSGGDLGTLTGAGLAVLRLDRMRALKDVY----- 81  Streptomyces
AAQ92405      98 --KgvEDEDRMVGFLPHCTFNLNGRAASIDTPLHGFVPFTHVDHMHPDAIIAIAASKNSRELTQQIFGNEIGWLPWRRPG 175 Rhizobium legum...
BAD62917      92 --A--MTDEEMVAYLGHCLIDPRHPRPSIETLLHAFLPFKHVDHTHPDAIISLCCAENGRELAEELFGDRFVWVPYIRPG 167 Bacillus clausi...
WP_012258146 106 rgPktAIEDAMVDLYPHCTFNLNPRASSIDTPLHAFIPYRHVDHMHPNAVIAIAASRNGERLTREIYGDEVIWMPWQRPG 185 Chloroflexus
WP_011027370  82 --PgvEHEDEMVAAFDYCLHGKGGAAPSIDTAMHGLVEAAHVDHLHPDSGIALACAADGEKLTAECFGDTVVWVPWRRPG 159 Streptomyces
AAQ92405     176 FQLGLDLEAFVKANPNAKGVVLESHGLFTWADDAKACYELTLEIINKAIVWFAEKTEGKTIFGGA--AVQSLPVAERRAI 253 Rhizobium legum...
BAD62917     168 FALSKMIAEQVDANPKAELVLMEKHGLVVWGETAKESYDRTISVINEAEQFIEKKRGKNAPFGGA--ATAGLKKEERQAL 245 Bacillus clausi...
WP_012258146 186 FDLGLKLEQICREHPQAKGVILGGHGLINWADDDQECYERTLDLIERAARYIEAHDRGEATFGGA--RYDALPFEQRRSV 263 Chloroflexus
WP_011027370 160 FQLGLDIAAVKEANPQAVGCVLGGHGITAWGDTSEECERNSLHIIRTAEAFLAERGKAE-PFGPVipAYAALPEAERRER 238 Streptomyces
AAQ92405     254 AARLMPEIRGRIGKQ-ERKLGHFDDQDAVLEFVNSRDLRPLGALGTSCPDHFLRTKIRPLIVDFDPAKPDVDAIVAGLDK 332 Rhizobium legum...
BAD62917     246 LANIMPVLRGAVAHNgRNMIVTYDDSDPILEFVNSKEAKELSQIGAACPDHLVHTKRLPLFIDWVPDASDEEGLKQAVLN 325 Bacillus clausi...
WP_012258146 264 LAAILPWLRGQISQQ-RRFIATIQDDATTLRFVNSVDAPRLAELGTSCPDHFLRTKIKPLYIDWHPQAETLDDLQRKLAV 342 Chloroflexus
WP_011027370 239 AAALAPYVRGLASRD-RAQVGHFTDADVVLDFLARAEHPRLAALGTSCPDHFLRTKVRPLVLDVAPTAP-LEEAVARLKE 316 Streptomyces
AAQ92405     333 ALEDYRADYARYYNDCKHdNSPTMRDANPVIFLVPGVGMLSFARDKATSRIASEFYVNAINVMRGASTVSEYQGLPEQEA 412 Rhizobium legum...
BAD62917     326 GIAAYKEDYIRYFERNRR-EGDTMFEPSPRVLLIPGIGLISSGKAVENAKVSRALYERAIAVMRGTNALGSFVSLNEAES 404 Bacillus clausi...
WP_012258146 343 GLERYRADYTHYYETHRRpDSPPMRDPNPSVILIPGLGMIAWGKDKSESRVTAEFYTAAIEVMRGAEAIDEYTALPLQEA 422 Chloroflexus
WP_011027370 317 LHAAYREEYAAYYERHAEpDSPAMRGADPAIVLVPGVGMFSFGKDKQTARVAGEFYVNAINVMRGAEAVSTYAPIEESEK 396 Streptomyces
AAQ92405     413 FDIEYWLLEEAKLQRMPKPKSLAGRVAFVTGGAGGIGRATAVRLVGEGACVVLADIDQAALESTEADFVKKFGADAVRS- 491 Rhizobium legum...
BAD62917     405 YEIEYWPLELYKLSLAPKEATFSRKVAFVTGGAGGIGSETSRQFAAQGAHVVLADLNLERAEEVAAEINGQFGAGRALA- 483 Bacillus clausi...
WP_012258146 423 FDIEYWQLEEAKLRRMPPEKELARQVIAVVGGGSGIGREVALRLANEGAHIVCVDKDGAAAQATAQAIIDRHGMGIGVAg 502 Chloroflexus
WP_011027370 397 FRIEYWALEEAKLRRMPRPKPLATRVALVTGAGSGIGKAIARRLVDEGACVVVADLNAENAAAVAEELG---GDDKAVA- 472 Streptomyces
AAQ92405     492 -----------VRLDVTKEDAVIASFAEASVEFGGVDILVSNAGIASSAPIEATE-LSTWNRNIDILATGYFLVSREAFR 559 Rhizobium legum...
BAD62917     484 -----------LKMDVTDEQAVKQAFADVARTYGGVDIVVNNAGLATSSPFDETT-LQEWQLNLDVLATGYFLVARQAFA 551 Bacillus clausi...
WP_012258146 503 sdisacgpaigLVADITDRTSVRTMLEQVVLAYGGLDAVAVTAGIFVAPDSEGRIrDEQWALTFAINVTGHYLVADEAAR 582 Chloroflexus
WP_011027370 473 -----------VTVDVTSEEQIAAAFQAAALAFGGVDLVVNNAGISISKPLLETS-AKDWDLQHDIMARGSFLVSREAAR 540 Streptomyces
AAQ92405     560 LFRRQALGGNIVFVASKNGLAASPNASAYCTAKAAEIHLARCLALEGADAGIRVNTVNPDAVLRGSKIWSGEWREQRAAS 639 Rhizobium legum...
BAD62917     552 QMKEQGTGGSMVFIGSKNSVYAGKNASAYSAAKAMEAHLARCIAAEGGTYGIRVNTVLPDAVLQGSAIWDSAWREERAAA 631 Bacillus clausi...
WP_012258146 583 IWRKQGLPANLVLTTSVNAVVAKKGSLAYDTSKAAANHLIRELAIELAPL-VRVNGVAPATVVQGSGMFPRERVIASLTK 661 Chloroflexus
WP_011027370 541 VMTAQELGGDIVYIASKNAVFAGPNNIAYSATKADQAHQVRLLAAELGEHGIRVNGVNPDGVVRGSGIFAGGWGAKRAAV 620 Streptomyces
AAQ92405     640 SKIE----------VDELEEHYRKRSMLKLNVYSEDIAEAIYFLASDLSAKSTGNIINVDAGNVQSFTR 698 Rhizobium leguminosarum bv...
BAD62917     632 YGIA----------ADELEDHYKKRTTLGVHIFPADIAEAVLFFASSKSEKTTGCMLTVDGGVPAAFPR 690 Bacillus clausii KSM-K16
WP_012258146 662 YGIPftadeptdvlTDKLARFYAERSLLKRPITPADQAEAFFLLLSQRLSQTTGQIITVDGGLHEAFLR 730 Chloroflexus
WP_011027370 621 YGVP----------EEKLGEFYAQRTLLKREVLPEHVANAVFALTGGDLTHTTGLHVPVDAGVAAAFLR 679 Streptomyces
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap