6XIA,1DID,1XIM,1BXB


Conserved Protein Domain Family
xylA_Arthro

?
TIGR02631: xylA_Arthro 
Click on image for an interactive view with Cn3D
xylose isomerase, Arthrobacter type
This model describes a D-xylose isomerase that is also active as a D-glucose isomerase. It is tetrameric and dependent on a divalent cation Mg2+, Co2+ or Mn2+ as characterized in Arthrobacter. Members of this family differ substantially from the D-xylose isomerases of family TIGR02630.
Statistics
?
PSSM-Id: 131679
View PSSM: TIGR02631
Aligned: 8 rows
Threshold Bit Score: 675.79
Threshold Setting Gi: 139840
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6XIA_A   2 YQPTPEDRFTFGLWTVGWEGRDPFGDATRTALDPVESVRRLAELGAHGVTFHDDDLIPFGSSDSERYEHVKRFRQALDDT 81  Streptomyces albus
P10654   3 LQATPDDKFSFGLWTVGWQARDAFGDATRPVLDPIEAVHKLAEIGAYGVTFHDDDLVPFGADAATRDGIVAGFSKALDET 82  Actinoplanes sp. ATCC...
P24299   3 YQPTPEDRFTFGLWTVGWEGRDPFGDATRTALDPVESVRRLAELGAHGVTFHDDDLIPFGSSDSERYEHVKRFRQALDDT 82  Streptomyces albus G
P26997   2 YEPKPEHRFTFGLWTVGNVGRDPFGDAVRERLDPVYVVHKLAELGAYGVNLHDEDLIPRGTPPQERDQIVRRFKKALDET 81  Thermus thermophilus HB8
P12070   3 VQPTPADHFTFGLWTVGWTGADPFGVATRKNLDPVEAVHKLAELGAYGITFHDNDLIPFDATEAEREKILGDFNQALKDT 82  Arthrobacter sp. NRRL...
1DID_A   2 VQPTPADHFTFGLWTVGWTGADPFGVATRKNLDPVEAVHKLAELGAYGITFHDNDLIPFDATEAEREKILGDFNQALKDT 81  Arthrobacter sp. NRRL...
1XIM_A   2 VQATREDKFSFGLWTVGWQARDAFGDATRTALDPVEAVHKLAEIGAYGITFHDDDLVPFGSDAQTRDGIIAGFKKALDET 81  Actinoplanes missouri...
1BXB_A   2 YEPKPEHRFTFGLWTVGNVGRDPFGDAVRERLDPVYVVHKLAELGAYGVNLHDEDLIPRGTPPQERDQIVRRFKKALDET 81  Thermus aquaticus
6XIA_A  82 GMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKEAF 161 Streptomyces albus
P10654  83 GLIVPMVTTNLFTHPVFKDGGFTSNDRSVRRYAIRKVLRQMDLGAELGAKTLVLWGGREGAEYDSAKDVGAALDRYREAL 162 Actinoplanes sp. ATCC...
P24299  83 GMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKEAF 162 Streptomyces albus G
P26997  82 GLKVPMVTANLFSDPAFKDGAFTSPDPWVRAYALRKSLETMDLGAELGAEIYVVWPGREGAEVEATGKARKVWDWVREAL 161 Thermus thermophilus HB8
P12070  83 GLKVPMVTTNLFSHPVFKDGGFTSNDRSIRRFALAKVLHNIDLAAEMGAETFVMWGGREGSEYDGSKDLAAALDRMREGV 162 Arthrobacter sp. NRRL...
1DID_A  82 GLKVPMVTTNLFSHPVFKDGGFTSNDRSIRRFALAKVLHNIDLAAEMGAETFVMWGGREGSEYDGSKDLAAALDRMREGV 161 Arthrobacter sp. NRRL...
1XIM_A  82 GLIVPMVTTNLFTHPVFKDGGFTSNDRSVRRYAIRKVLRQMDLGAELGAKTLVLWGGREGAEYDSAKDVSAALDRYREAL 161 Actinoplanes missouri...
1BXB_A  82 GLKVPMVTANLFSDPAFKDGAFTSPDPWVRAYALRKSLETMDLGAELGAEIYVVWPGREGAEVEATGKARKVWDWVREAL 161 Thermus aquaticus
6XIA_A 162 DLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGKLF 241 Streptomyces albus
P10654 163 NLLAQYSEDQGYGLPFAIEPKPNEPRGDILLPTAGHAIAFVQELERPELFGINRETGHEQMSNLNFTQGIAQALWHKKLF 242 Actinoplanes sp. ATCC...
P24299 163 DLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGKLF 242 Streptomyces albus G
P26997 162 NFMAAYAEDQGYGYRFALEPKPNEPRGDIYFATVGSMLAFIHTLDRPERFGLNPEFAHETMAGLNFVHAVAQALDAGKLF 241 Thermus thermophilus HB8
P12070 163 DTAAGYIKDKGYNLRIALEPKPNEPRGDIFLPTVGHGLAFIEQLEHGDIVGLNPETGHEQMAGLNFTHGIAQALWAEKLF 242 Arthrobacter sp. NRRL...
1DID_A 162 DTAAGYIKDKGYNLRIALEPKPNEPRGDIFLPTVGHGLAFIEQLEHGDIVGLNPETGHEQMAGLNFTHGIAQALWAEKLF 241 Arthrobacter sp. NRRL...
1XIM_A 162 NLLAQYSEDRGYGLRFAIEPKPNEPRGDILLPTAGHAIAFVQELERPELFGINPETGHEQMSNLNFTQGIAQALWHKKLF 241 Actinoplanes missouri...
1BXB_A 162 NFMAAYAEDQGYGYRFALEPKPNEPRGDIYFATVGSMLAFIHTLDRPERFGLNPEFAHETMAGLNFVHAVAQALDAGKLF 241 Thermus aquaticus
6XIA_A 242 HIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESA------GYSGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKER 315 Streptomyces albus
P10654 243 HIDLNGQHGPKFDQDLVFGHGDLLNAFSLVDLLENGpdg-gpAYDGPRHFDYKPSRTEDFDGVWESAKDNIRMYLLLKER 321 Actinoplanes sp. ATCC...
P24299 243 HIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESA------GYSGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKER 316 Streptomyces albus G
P26997 242 HIDLNDQRMSRFDQDLRFGSENLKAAFFLVDLLESS------GYQGPRHFDAHALRTEDEEGVWAFARGCMRTYLILKER 315 Thermus thermophilus HB8
P12070 243 HIDLNGQRGIKYDQDLVFGHGDLTSAFFTVDLLENGfpnggpKYTGPRHFDYKPSRTDGYDGVWDSAKANMSMYLLLKER 322 Arthrobacter sp. NRRL...
1DID_A 242 HIDLNGQRGIKYDQDLVFGHGDLTSAFFTVDLLENGfpnggpKYTGPRHFDYKPSRTDGYDGVWDSAKANMSMYLLLKER 321 Arthrobacter sp. NRRL...
1XIM_A 242 HIDLNGQHGPKFDQDLVFGHGDLLNAFSLVDLLENGpdg-apAYDGPRHFDYKPSRTEDYDGVWESAKANIRMYLLLKER 320 Actinoplanes missouri...
1BXB_A 242 HIDLNDQRMSRFDQDLRFGSENLKAAFFLVDLLESS------GYQGPRHFDAHALRTEDEEGVWAFARGCMRTYLILKER 315 Thermus aquaticus
6XIA_A 316 AAAFRADPEVQEALRASRLDELARPTAAD--G--LQALLDDRSAFEEFDVDAAAARGMAFERLDQLAMDHLL 383 Streptomyces albus
P10654 322 AKAFRADPEVQAALAESKVDELRTPTLNP--GetYADLLADRSAFEDYDADAVGAKGYGFVKLNQLAIDHLL 391 Actinoplanes sp. ATCC 31351
P24299 317 AAAFRADPEVQEALRASRLDELARPTAAD--G--LQALLDDRSAFEEFDVDAAAARGMAFERLDQLAMDHLL 384 Streptomyces albus G
P26997 316 AEAFREDPEVKELLAAYYQEDPAALALLG--P--YSREKAEALKRAELPLEAKRRRGYALERLDQLAVEYLL 383 Thermus thermophilus HB8
P12070 323 ALAFRADPEVQEAMKTSGVFELGETTLNA--GesAADLMNDSASFAGFDAEAAAERNFAFIRLNQLAIEHLL 392 Arthrobacter sp. NRRL B3728
1DID_A 322 ALAFRADPEVQEAMKTSGVFELGETTLNA--GesAADLMNDSASFAGFDAEAAAERNFAFIRLNQLAIEHLL 391 Arthrobacter sp. NRRL B3728
1XIM_A 321 AKAFRADPEVQEALAASKVAELKTPTLNPgeG--YAELLADRSAFEDYDADAVGAKGFGFVKLNQLAIEHLL 390 Actinoplanes missouriensis
1BXB_A 316 AEAFREDPEVKELLAAYYQEDPAALALLG--P--YSREKAEALKRAELPLEAKRRRGYALERLDQLAVEYLL 383 Thermus aquaticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap