2HCV


Conserved Protein Domain Family
L_rham_iso_rhiz

?
TIGR02629: L_rham_iso_rhiz 
Click on image for an interactive view with Cn3D
L-rhamnose catabolism isomerase, Pseudomonas stutzeri subtype
Members of this family are isomerases in the pathway of L-rhamnose catabolism as found in Pseudomonas stutzeri and in a number of the Rhizobiales. This family differs from the L-rhamnose isomerases of Escherichia coli (see TIGR01748). This enzyme catalyzes the isomerization step in rhamnose catabolism. Genetic evidence in Rhizobium leguminosarum bv. trifolii suggests phosphorylation occurs first, then isomerization of the the phosphorylated sugar, but characterization of the recombinant enzyme from Pseudomonas
Statistics
?
PSSM-Id: 131677
View PSSM: TIGR02629
Aligned: 4 rows
Threshold Bit Score: 874.352
Threshold Setting Gi: 122920358
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HCV_A    10 VVARENDRRASALKEDYEALGANLARRGVDIEAVTAKVEKFFVAVPSWGVGTGGTRFARFPGTGEPRGIFDKLDDCAVIQ 89  Pseudomonas stutzeri
BAD14073  10 VVARENDRRASALKEDYEALGANLARRGVDIEAVTAKVEKFFVAVPSWGVGTGGTRFARFPGTGEPRGIFDKLDDCAVIQ 89  Pseudomonas stutzeri
Q98B65    10 VVEKNNAARKPDLERDYASLGERLDRRGIAIDAIRAKVEKFAVAIPSWGVGTGGTRFARFPGAGEPRDIFDKIEDCAVIS 89  Mesorhizobium loti ...
Q92S14     9 VLDAENASRRDALTRDYESLGDRLARRGIDIDAVKAKVAAYGVAVPSWGVGTGGTRFARFPGPGEPRNIFDKLEDCAVIQ 88  Sinorhizobium melil...
2HCV_A    90 QLTRATPNVSLHIPWDKA-DPKELKARGDALGLGFDAMNSNTFSDAPGQAHSYKYGSLSHTNAATRAQAVEHNLECIEIG 168 Pseudomonas stutzeri
BAD14073  90 QLTRATPNVSLHIPWDKA-DPKELKARGDALGLGFDAMNSNTFSDAPGQAHSYKYGSLSHTDAATRAQAVEHNLECIEIG 168 Pseudomonas stutzeri
Q98B65    90 QLTQATPTVSLHIPWDKA-DPNRLKQAASRFGLGFDAMNSNTFSDARDQKLSYKFGSLSHADAGTRRQAVEHNLECIEIG 168 Mesorhizobium loti ...
Q92S14    89 QLTRATPAVSLHIPWDKVsDLGALKEKGSALGLSFDAMNSNTFSDAPGQAHSYKFGSLSHTDSATRRQAIEHNLECVEIG 168 Sinorhizobium melil...
2HCV_A   169 KAIGSKALTVWIGDGSNFPGQSNFTRAFERYLSAMAEIYKGLPDDWKLFSEHKMYEPAFYSTVVQDWGTNYLIAQTLGPK 248 Pseudomonas stutzeri
BAD14073 169 KAIGSKALTVWIGDGSNFPGQSNFTRAFERYLSAMAEIYKGLPDDWKLFSEHKMYEPAFYSTVVQDWGTNYLIAQTLGPK 248 Pseudomonas stutzeri
Q98B65   169 KTLGSKALTVWIGDGSNFPGQVNFARAFERYLDAMKAVYAGLPADWKLFTEHKMYEPAFYSTVVQDWGTNYLIAKELGDR 248 Mesorhizobium loti ...
Q92S14   169 KALGSKALTVWVGDGSNFPGQSNFTRAFERYLDSMKAVYAALPDDWRIFTEHKMFEPAFYSTVVQDWGTNYLIAQELGPK 248 Sinorhizobium melil...
2HCV_A   249 AQCLVDLGHHAPNTNIEMIVARLIQFGKLGGFHFNDSKYGDDDLDAGAIEPYRLFLVFNELVDAEARGVKGFHPAHMIDQ 328 Pseudomonas stutzeri
BAD14073 249 AQCLVDLGHHAPNTNIEMIVARLIQFGKLGGFHFNDSKYGDDDLDAGAIEPYRLFLVFNELVDAEARGVKGFHPAHMIDQ 328 Pseudomonas stutzeri
Q98B65   249 AFCLVDLGHHAPNVNIEMIVSRLIQFKKLGGFHFNDSKYGDDDLDAGSIDPYRLFLVFNELVDAELSGAEGFDPAHMLDQ 328 Mesorhizobium loti ...
Q92S14   249 AFCLVDLGHHAPNVNIEMIVARLIQFKKLGGFHFNDSKYGDDDLDTGSIDPYRLFLVFNELVDAETRAANGFDPAHMLDQ 328 Sinorhizobium melil...
2HCV_A   329 SHNVTDPIESLINSANEIRRAYAQALLVDRAALSGYQEDNDALMATETLKRAYRTDVEPILAEARRRTGGAVDPVATYRA 408 Pseudomonas stutzeri
BAD14073 329 SHNVTDPIESLINSANEIRRAYAQALLVDRAALSGYQEDNDALMATETLKRAYRTDVEPILAEARRRTGGAVDPVATYRA 408 Pseudomonas stutzeri
Q98B65   329 SHNVTDPIESLMLSAVEVQRAYAQALLVDRKALEGFQDGNDALMATQTLKAAYRTDVEPILAMARLKTGGAIDPVATYRA 408 Mesorhizobium loti ...
Q92S14   329 SHNVTDPIESLMTSAMEVGRAYAQALIVDRKALAGYQEENDALMASETLKTAFRTDVEPILATARLENDGAIAPVAAYRA 408 Sinorhizobium melil...
2HCV_A   409 SGYRARVAAERPA 421 Pseudomonas stutzeri
BAD14073 409 SGYRARVAAERPA 421 Pseudomonas stutzeri
Q98B65   409 AGYRAKVAAERPA 421 Mesorhizobium loti MAFF303099
Q92S14   409 SGYRARVAAERPA 421 Sinorhizobium meliloti 1021
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap