Conserved Protein Domain Family
fuculo_kin_coli

?
TIGR02628: fuculo_kin_coli 
L-fuculokinase
Members of this family are L-fuculokinase, from the clade that includes the L-fuculokinase of Escherichia coli. This enzyme catalyzes the second step in fucose catabolism. This family belongs to FGGY family of carbohydrate kinases (pfam02782, pfam00370). It is encoded by the kinase (K) gene of the fucose (fuc) operon. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 131676
View PSSM: TIGR02628
Aligned: 3 rows
Threshold Bit Score: 838.011
Threshold Setting Gi: 120588
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC94942   2 SVVIVLDCGATNLRAIAIDSQGKIVASYFVKNETKQDINNPDYHIWDFEQIWTKLVECG-----QKVIAEVGAKNVLALT 76  Vibrio vulnificus Y...
P44399     2 AIALIFDCGATNLRTIAINEKGQILASHHLANNTKQGIESSDYHIWDIEEIWQKLTSCAtqtlnQLMQQGIDLKDIVGIS 81  Haemophilus influen...
P11553    14 EVILVLDCGATNVRAIAVNRQGKIVARASTPNASDIAMENNTWHQWSLDAILQRFADCC-----RQINSELTECHIRGIA 88  Escherichia coli K-12
BAC94942  77 VTTFGVDGAPFDNQGNQLYPIISWKCPRTVPVMKQVEQELDRLQLYRDNGIGDYSFNTLYKLRWFQQHQPQLFEQMDKFV 156 Vibrio vulnificus Y...
P44399    82 VTTFGVDGAPFDENDQQLYPIISWKCPRTIPVMENLSNQLDIKSLYQRNGIGQYSFNTLFKLHWLKTHKPDVFQKMAKFV 161 Haemophilus influen...
P11553    89 VTTFGVDGALVDKQGNLLYPIISWKCPRTAAVMDNIERLISAQRLQAISGVGAFSFNTLYKLVWLKENHPQLLERAHAWL 168 Escherichia coli K-12
BAC94942 157 FISSMITHQLTGVWSTDYTMAGTSMMTDLTLCNWNPAVLEYLGLSEEQFPPLVMAGDVIGSVTSDIAKLLGLGAdVPVIS 236 Vibrio vulnificus Y...
P44399   162 FISSMLTQRLTGQFTTDHTMAGTSMMTNLTSGNWDPSILASLGLSNNHFPPMRYAGEKVGKLRTPLAQKWGLNP-VPVIS 240 Haemophilus influen...
P11553   169 FISSLINHRLTGEFTTDITMAGTSQMLDIQQRDFSPQILQATGIPRRLFPRLVEAGEQIGTLQNSAAAMLGLPVgIPVIS 248 Escherichia coli K-12
BAC94942 237 AGHDTQFALVGSGAAENQAFLSSGTWEILMARSQRPQLDVHALQHGVTVELDSVKGFYNPAIQWLSSAVVEWVANQFFTA 316 Vibrio vulnificus Y...
P44399   241 CGHDTQFAVFGSGAGLNQPVLSSGTWEILMARTQHAEPRFEFVSQGLTTEFDAQSNCFNPAVQWVGSGVIEWLGKLLFSD 320 Haemophilus influen...
P11553   249 AGHDTQFALFGAGAEQNEPVLSSGTWEILMVRSAQVDTSLLSQYAGSTCELDSQAGLYNPGMQWLASGVLEWVRKLFWTA 328 Escherichia coli K-12
BAC94942 317 EQASGELYKVMIEEAREVGNGASGVVfkpNFTTNADGIGQGAIEGLGLHTNRGQIARAVFEGLSKQLKQRFDYLSQLCQL 396 Vibrio vulnificus Y...
P44399   321 VYGSDHYYTTMIKEGEKAFNAGKRAV---NFEGIFSQLGQGNISGLSMFATRGEIYVSALQHMANKLKNGLSVLHQVSQF 397 Haemophilus influen...
P11553   329 ETP----WQMLIEEARLIAPGADGVK----MQCDLLSCQNAGWQGVTLNTTRGHFYRAALEGLTAQLQRNLQMLEKIGHF 400 Escherichia coli K-12
BAC94942 397 SDGPVVVVGGGTKNDLWNQLRADALQRSLHIVEQAEATVIGAAMFAFTGSGFYPDIDSAQAQMKPSLRVVNPS 469 Vibrio vulnificus YJ016
P44399   398 QAKSLICVGGGSKNVLWNQIRANTLNLPIDVVDISESTVLGAAMFTFAGVGIYENVNAAQQAMQPTRKRIYPN 470 Haemophilus influenzae Rd ...
P11553   401 KASELLLVGGGSRNTLWNQIKANMLDIPVKVLDDAETTVAGAALFGWYGVGEFNSPEEARAQIHYQYRYFYPQ 473 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap