1X8D


Conserved Protein Domain Family
YiiL_rotase

?
TIGR02625: YiiL_rotase 
Click on image for an interactive view with Cn3D
L-rhamnose mutarotase
Members of this protein family are rhamnose mutarotase from Escherichia coli, previously designated YiiL as an uncharacterized protein, and close homologs also associated with rhamnose dissimilation operons in other bacterial genomes. Mutarotase is a term for an epimerase that changes optical activity. This enzyme was shown experimentally to interconvert alpha and beta stereoisomers of the pyranose form of L-rhamnose. The crystal structure of this small (104 amino acid) protein shows a locally asymmetric dimer with active site residues of His, Tyr, and Trp. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 131674
View PSSM: TIGR02625
Aligned: 8 rows
Threshold Bit Score: 183.098
Threshold Setting Gi: 497599286
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1X8D_A         3 RKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYLDKARNLLFAMVEIESEERWNAVASTDVCQRWWKYMTD 82  Escherichia col...
P32156         3 RKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYLDKARNLLFAMVEIESEERWNAVASTDVCQRWWKYMTD 82  Escherichia col...
CAG73352       3 RKAFVMSVFPDSHDEYQRRHNPIWPELAEVLKNHGAHHYSIFLDKQRNLLFGYVEVESEARWEAIAQTDVCQRWWKHMGD 82  Pectobacterium ...
AAU38931      18 RKGFVMQVNPDCHAEYKKRHDEIFPELVEELKSHGAHHYSIFLDKQRNLLFGYVEIENEQRWNDVAKTAACRKWWAFMRD 97  Mannheimia succ...
BAC12449       3 RKGFIMTVYPDKHDEYEKRHNEIWPEMVAELKKHGAHNYSIFLDKQTNQLFGYIEIEDEEKWSKMAETSINQKWWKFMKP 82  Oceanobacillus ...
CAD65671       3 RLGQVMYLHKDAYEEYAKRHAELWPEMKTALKKYGATNYSIFLNKLTGQTFAYLEVPDEATYNEIAETDICKKWWKYMEP 82  Lactobacillus p...
WP_009913470   3 RVASIMYLYPGNKEEYKKRHDELWPEMKEALKAHGAANYSIFLDEKTDTLFAYVEVEDKAIYDKIAETEICQKWWKYMAP 82  Listeria monocy...
AAS60751       4 RKAFVMAVNPDAHAEYQRRHTPIWPELESVLKAHGAHHYSIFLDETRNLLFGVVEIESEERWNAVAQTAECQRWWQHMAD 83  Yersinia pestis...
1X8D_A        83 VMPANPDNSPVSSELQEVFYLP 104 Escherichia coli BW2952
P32156        83 VMPANPDNSPVSSELQEVFYLP 104 Escherichia coli K-12
CAG73352      83 VMPSNPDNSPISDALDPVFYLD 104 Pectobacterium atrosepticum SCRI1043
AAU38931      98 VMPSNPDNSPVSQELEQVFYLD 119 Mannheimia succiniciproducens MBEL55E
BAC12449      83 VMKTNSDDSPVSTDLTEVFHMD 104 Oceanobacillus iheyensis HTE831
CAD65671      83 LMDTNEDNSPVTTDLQEVFHLD 104 Lactobacillus plantarum WCFS1
WP_009913470  83 IMKSNPNNSPVAVDLKEVFYLA 104 Listeria monocytogenes
AAS60751      84 VMPSHPDNSPVSQALREVFYLE 105 Yersinia pestis biovar Microtus str. 91001
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap