1GT7


Conserved Protein Domain Family
rhamnu_1P_ald

?
TIGR02624: rhamnu_1P_ald 
Click on image for an interactive view with Cn3D
rhamnulose-1-phosphate aldolase
Members of this family are the enzyme RhaD, rhamnulose-1-phosphate aldolase.
Statistics
?
PSSM-Id: 131673
View PSSM: TIGR02624
Aligned: 7 rows
Threshold Bit Score: 506.626
Threshold Setting Gi: 357528923
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GT7_A   1 MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDnFHQQPRYIPLSQPMPLLANTPFIVTGSGKFFR 80  Escherichia coli BW2952
Q8ESW9   7 QQDVLDAPFMKEMMNTTYDMWKLGWDELNGGNISYLLKEEEVRSYFD-LNQVKRTISLDFPVIELANQYFLVTGSGKFFR 85  Oceanobacillus iheyen...
Q8Y3I8   2 TKDIMDAVFIKEMAKTTSNLYRLGWDERNGGNITYLLDEKEVAEYLD-VKQIIRTIPMDFDGKKLAGKYFLVTGSGKYFK 80  Listeria monocytogene...
Q838L1   1 -MNVLQAPFVEEMVKTTKNLYRLGWDERNGGNISYLLKEEEILPFLN-PTQVLRKIPMKFDATKLAGKYFIVTGSGKYFK 78  Enterococcus faecalis...
Q8ZJ03   1 MQAILSSWFIQGMIKATSDMWHKGWDERNGGNISLRLLAEEVEPYRRdFYQQPRKVELTQPAPELANSWFLVTGSGKFFR 80  Yersinia pestis
Q88S52   3 MTDFIDSPYVRDMAQTTENLYRHGWDERNGGNVSLRLTKEEVEAYAG-TDKVLRQIPIKFDASELAGKYYLVTGTGRYFK 81  Lactobacillus plantar...
P32169   1 MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDnFHQQPRYIPLSQPMPLLANTPFIVTGSGKFFR 80  Escherichia coli K-12
1GT7_A  81 NVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPAHFLSHCERIKATNgKDRVIMHCHATNLIALTYVLENDTAV 160 Escherichia coli BW2952
Q8ESW9  86 KIIENPEECLAVLRVTSDGESVELLWGLSDGGRPTSELASHFMSHIVRLKHDP-NHRVIMHTHATNLIAMTFTHELDEVQ 164 Oceanobacillus iheyen...
Q8Y3I8  81 NVEEAPAVNLGVIQVSEDGKAVHLLWGYTDGGLPTSELPAHFMSHIARLSVDP-ENRVVMHCHATHLLAMTFTHELTERA 159 Listeria monocytogene...
Q838L1  79 NVCDASSENLGILRVSENGQELELLWGLEDEAVPTSELPSHFMSHIARLAVDP-ENRIVMHNHASHLLAMSFTHELDEKV 157 Enterococcus faecalis...
Q8ZJ03  81 NVELNPAENLVLLQVSNDGMAYHIHWGLTQGGLPTSELAAHFQSHIVRMQVSGgTNRVIMHCHATNLIALSYVQKLENAS 160 Yersinia pestis
Q88S52  82 NMVEFPERDMGLIRISEVGNSVDLMWGFNDGGEPTSEFPSHLMSHIARLKQDP-DQRVIMHCHPTNLVAMTFTIPLSSKR 160 Lactobacillus plantar...
P32169  81 NVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPAHFLSHCERIKATNgKDRVIMHCHATNLIALTYVLENDTAV 160 Escherichia coli K-12
1GT7_A 161 FTRQLWEGSTECLVVFPDGVGILPWMVPGTDEIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK 240 Escherichia coli BW2952
Q8ESW9 165 FTRTLWQMCTECLVVFPEGVGILPWMVPGTSEIGKATAEKMNEYRLAIWSHHGIFGAGESIDQVFGLIETVEKAAKVYNL 244 Oceanobacillus iheyen...
Q8Y3I8 160 FTRTLWQMCTECLVVFPEGVGIIPWLVPGTNEIGEATSEKMKENRLIVWPHHGIYGAGQSMDETFGLIETAEKAAEVYTI 239 Listeria monocytogene...
Q838L1 158 FTRTLWQMCTECLVVFPDGVGIIPWLVPGTNEIGVATAEKMKESRLVLWPQHGIYGTGRDMDEVFGLIETAEKAAEVYTY 237 Enterococcus faecalis...
Q8ZJ03 161 FTRLLWEGSTECLVVFPDGIGIVPWMVPGTDGIGTQTAEQMREHSLVLWPFHGIFGSGPTLDDAFGLIDTAEKSAEIMVK 240 Yersinia pestis
Q88S52 161 FSRTLWKMHPESIVVFPEGVGVIPYMCPGTNEIGEKTAAKMADYRVVVWPHHGVFAAGDSLDETYGLVETVEKSALIYTT 240 Lactobacillus plantar...
P32169 161 FTRQLWEGSTECLVVFPDGVGILPWMVPGTDEIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK 240 Escherichia coli K-12
1GT7_A 241 VYSM-GGMKQTISREELIALGKRFGVTPLASAL 272 Escherichia coli BW2952
Q8ESW9 245 VNAHpDGAKQVITDQQLIDLAEAFHVNPPNKYF 277 Oceanobacillus iheyensis HTE831
Q8Y3I8 240 VMSQ-GGIKQAITDEQLKALGERFGVEAKAGYL 271 Listeria monocytogenes EGD-e
Q838L1 238 VCAQ-GGVRQTISDADLWRLAEAFGVTPKVGYL 269 Enterococcus faecalis V583
Q8ZJ03 241 VLSM-GGKKQTISREQLIALAARFDVTPMAAAL 272 Yersinia pestis
Q88S52 241 IREQgGEVLQSLTDKDFRDLIKRFDLKANEDFL 273 Lactobacillus plantarum WCFS1
P32169 241 VYSM-GGMKQTISREELIALGKRFGVTPLASAL 272 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap