1TZF


Conserved Protein Domain Family
G1P_cyt_trans

?
TIGR02623: G1P_cyt_trans 
Click on image for an interactive view with Cn3D
glucose-1-phosphate cytidylyltransferase
Members of this family are the enzyme glucose-1-phosphate cytidylyltransferase, also called CDP-glucose pyrophosphorylase, the product of the rfbF gene. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 131672
View PSSM: TIGR02623
Aligned: 7 rows
Threshold Bit Score: 499.282
Threshold Setting Gi: 21113136
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TZF_A     4 KAVILAGGLGTRLSEETIVKPKPMVEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVIKEYFANYFLHMSDVTFHM-AE 82  Salmonella enterica...
BAD79630   2 KAVILAGGLGTRLSEETHLRPKPMVEVGGKPILWHILKIYSHFGIQEFIICCGYKGYLIKDYFANYFLYTSDVTFHMdID 81  Synechococcus elong...
AAQ61554   2 KAVILAGGLGTRISEESHLRPKPMIEIGGKPIIWHILKIYSAHGINDFIICLGYKGYVIKEYFANYFLHTSDVTLDL-SN 80  Chromobacterium vio...
CAE29489   2 KVVLLAGGLGTRISEESALRPKPMIEIGGRPILWHIMKIYLAHGLRDFVICCGYKGYMIKEYFANYSLHMSDITIDM-EN 80  Rhodopseudomonas pa...
AAM41304   2 KAVILAGGLGTRISEETAIRPKPMVEIGGKPILWHIMKIYAYHGINEFVVCLGYRGEVIKDFFMNYHMRESDVTCDL-GS 80  Xanthomonas campest...
AAS42303   2 KAVILAGGYGTRIGEETHLKPKPMIEIGTKPILWHIMSLYSHYGITEFIICLGYKGYAIKEFFLNYNLHMSDFTIHL-RD 80  Bacillus cereus ATC...
P26396     2 KAVILAGGLGTRLSEETIVKPKPMVEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVIKEYFANYFLHMSDVTFHM-AE 80  Salmonella enterica...
1TZF_A    83 NRMEVHHKRVEPWNVTLVDTGDSSMTGGRLKRVAEYVkD-DEAFLFTYGDGVADLDIKATIDFHKAHGKKATLTATFPPG 161 Salmonella enterica...
BAD79630  82 NHMEVHHRKSEPWKVTLVDTGEMSQTGGRLGRVRHYL-N-DETFCFTYGDGVADVNIHALVQHHQKAECQATLTAVQPPG 159 Synechococcus elong...
AAQ61554  81 NQMFVHERHAEPWRVTLVDTGESTQTGGRLGRVRRHL-EnEQDFCFTYGDGVSDIDITAAVAYHRSQGVEATVTAVHPPG 159 Chromobacterium vio...
CAE29489  81 ESIEIHRKKTEPWRVTLVDTGEATQTGGRLKRIADYI-D--GDFCLTYGDGVGSINITELLMFHRSHGKPATMTATQPPG 157 Rhodopseudomonas pa...
AAM41304  81 NTTTLHNTRAEPWRVTLVDTGAQTMTGGRLRRVREHL-HgDDAFCMTYGDGVADIDIGAAIALHRREGRLATVSAVQPPG 159 Xanthomonas campest...
AAS42303  81 NTITSHSHRVEPWKVTLIDTGVNTETGGRVKRIQNFV-G-DEPFCLTYGDGLSNVNIKELIAFHKKHGKMATVTAVQPPG 158 Bacillus cereus ATC...
P26396    81 NRMEVHHKRVEPWNVTLVDTGDSSMTGGRLKRVAEYV-KdDEAFLFTYGDGVADLDIKATIDFHKAHGKKATLTATFPPG 159 Salmonella enterica...
1TZF_A   162 RFGALDIQAGQVRSFQEKPKGDGAMINGGFFVLNPSVIDLIDNDATTWEQEPLMTLAQQGELMAFEHPGFWQPMDTLRDK 241 Salmonella enterica...
BAD79630 160 RYGALSLEGDTVLQFQEKPEGDNAWINGGFFVLEPNVLDLIADDSCSWEGEILPQLAAAGQLSAYRHRGFWQPMDTLRDR 239 Synechococcus elong...
AAQ61554 160 RFGALEIRDERVEFFKEKPRGDGGMINGGFFVLNPSVLDLIDSDDCVWESEPLETLASRGQLAAYEHSGFWQPMDTLRDK 239 Chromobacterium vio...
CAE29489 158 RFGALQLNGKSVTSFLEKPTGDGGWINGGFFVLSPKVLDRIDGDMTIWEREPLESLAQNGELQAYFHSGFWQPMDTLRDK 237 Rhodopseudomonas pa...
AAM41304 160 RFGALRVEGEQVTGFREKPLDGDGLINGGFFVLDPRVIDVIEGDATVWENSPLETLVDRGELSVYRHEGFWQPMDTLRDR 239 Xanthomonas campest...
AAS42303 159 RFGSLILDKQSVTSFQEKPLGDGGWVNGGFFVLNPEVFNYISGDKSVFETDTLVQLVNKNELSAYQHTGFWHPMDTLRDK 238 Bacillus cereus ATC...
P26396   160 RFGALDIRAGQVRSFQEKPKGDGAMINGGFFVLNPSVIDLIDNDATTWEQEPLMTLAQQGELMAFEHPGFWQPMDTLRDK 239 Salmonella enterica...
1TZF_A   242 VYLEGLWEKGKAPWKTW 258 Salmonella enterica subsp. enterica serovar Typhi str. CT18
BAD79630 240 TRLEELWANNQAPWKLW 256 Synechococcus elongatus PCC 6301
AAQ61554 240 TLLEELWQSGEAPWKLW 256 Chromobacterium violaceum ATCC 12472
CAE29489 238 NHLENLWQSGRAPWKMW 254 Rhodopseudomonas palustris CGA009
AAM41304 240 NYLETLWSSNRAPWRVW 256 Xanthomonas campestris pv. campestris str. ATCC 33913
AAS42303 239 NKLVELWESNNAPWKVW 255 Bacillus cereus ATCC 10987
P26396   240 VYLEGLWEKGKAPWKTW 256 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap