
Conserved Protein Domain Family

TIGR02618: tyr_phenol_ly 
Click on image for an interactive view with Cn3D
tyrosine phenol-lyase
This model describes a group of tyrosine phenol-lyase ( (beta-tyrosinase), a pyridoxal-phosphate enzyme closely related to tryptophanase ( (see model TIGR02617). Both belong to the beta-eliminating lyase family (pfam01212) [Energy metabolism, Amino acids and amines]
PSSM-Id: 131667
Aligned: 4 rows
Threshold Bit Score: 932.406
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q9CMK9 406 LTIPRRVYTYAHLDHVADTIIKLFKHRDDIKGLDMVYEPKLLRFFTARFE 455 Pasteurella multocida subsp. multocida str. Pm70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap