2EZ2


Conserved Protein Domain Family
tyr_phenol_ly

?
TIGR02618: tyr_phenol_ly 
Click on image for an interactive view with Cn3D
tyrosine phenol-lyase
This model describes a group of tyrosine phenol-lyase (4.1.99.2) (beta-tyrosinase), a pyridoxal-phosphate enzyme closely related to tryptophanase (4.1.99.1) (see model TIGR02617). Both belong to the beta-eliminating lyase family (pfam01212) [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 131667
View PSSM: TIGR02618
Aligned: 4 rows
Threshold Bit Score: 932.406
Threshold Setting Gi: 112490535
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2EZ2_A   5 AEPFRIKSVETVSMIPRDERLKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLERTV 84  Citrobacter freundii
Q9CMK9   6 AEPYKVKAVEPIAMTTREQREAYMKKAGYNTFLLNSEEVYIDLLTDSGTSAMSDKQWAGLMIGDEAYAGSRNFMHLQDVV 85  Pasteurella multocida...
Q08897   6 AEPYKIKAVEPIRMTTREYREQAIREAGYNTFLLRSEDVYIDLLTDSGTNAMSDRQWGALMMGDEAYAGARSFFRLEEAV 85  Symbiobacterium therm...
P31013   5 AEPFRIKSVETVSMIPRDERLKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLERTV 84  Citrobacter freundii
2EZ2_A  85 QELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLNIAFKGDIDLKKLQ 164 Citrobacter freundii
Q9CMK9  86 REYYGFKYVVPTHQGRGAENLLSTIMIKPGDYVPGNMYFTTTRAHQERNGATFVDIIIDEAHDSQIDLPFKGNVDVKKLQ 165 Pasteurella multocida...
Q08897  86 REIYGFKYVVPTHQGRGAEHLISRILIKPGDYIPGNMYFTTTRTHQELQGGTFVDVIIDEAHDPQASHPFKGNVDIAKFE 165 Symbiobacterium therm...
P31013  85 QELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLNIAFKGDIDLKKLQ 164 Citrobacter freundii
2EZ2_A 165 KLIDEKGAENIAYICLAVTVNLAGGQPVSMANMRAVRELTEAHGIKVFYDATRCVENAYFIKEQEQGFENKSIAEIVHEM 244 Citrobacter freundii
Q9CMK9 166 KLIDEVGADKIPYICLAVTVNLAGGQPVSMANMREVKALCSKHGIKVMFDATRCVENAYFIKEREAEYKDATIKDILKEM 245 Pasteurella multocida...
Q08897 166 ALIDRVGADKIPYINVALTVNMAGGQPVSMANLREVRKVCDRHGIRMWSDATRAVENAYFIKEREEGYQDKPVREILKEM 245 Symbiobacterium therm...
P31013 165 KLIDEKGAENIAYICLAVTVNLAGGQPVSMANMRAVRELTEAHGIKVFYDATRCVENAYFIKEQEQGFENKSIAEIVHEM 244 Citrobacter freundii
2EZ2_A 245 FSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRVKQVRY 324 Citrobacter freundii
Q9CMK9 246 MSYADGCTMSGKKDCLVNIGGFLCINDDDLYQQACELVVLFEGMPSYGGLAGRDMEAMAIGITESVDFHYIQHRVAQCYY 325 Pasteurella multocida...
Q08897 246 MSYFDGCTMSGKKDCLVNIGGFLAMNEEWILQKAREQVVIFEGMPTYGGLAGRDMEAIAQGIYEMVDDDYIAHRIHQVRY 325 Symbiobacterium therm...
P31013 245 FSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRVKQVRY 324 Citrobacter freundii
2EZ2_A 325 LGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVETGVRSMERGIISAGRNNVTGEHHRPKLETVR 404 Citrobacter freundii
Q9CMK9 326 LADKLEAAGVPIVKPVGGHAVFLDAKKFLPHIPQEQFPAQMLAAQIYIEGGVRSMERGIVSAGRDKKTGANHTPKLELVR 405 Pasteurella multocida...
Q08897 326 LGEQLLEAGIPIVQPIGGHAVFLDARAFLPHIPQDQFPAQALAAALYVDSGVRAMERGIVSAGRNPQTGEHNYPKLELVR 405 Symbiobacterium therm...
P31013 325 LGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVETGVRSMERGIISAGRNNVTGEHHRPKLETVR 404 Citrobacter freundii
2EZ2_A 405 LTIPRRVYTYAHMDVVADGIIKLYQHKEDIRGLKFIYEPKQLRFFTARFD 454 Citrobacter freundii
Q9CMK9 406 LTIPRRVYTYAHLDHVADTIIKLFKHRDDIKGLDMVYEPKLLRFFTARFE 455 Pasteurella multocida subsp. multocida str. Pm70
Q08897 406 LTIPRRVYTDRHMDVVAYSVKHLWKERDTIRGLRMVYEPPTLRFFTARFE 455 Symbiobacterium thermophilum IAM 14863
P31013 405 LTIPRRVYTYAHMDVVADGIIKLYQHKEDIRGLKFIYEPKQLRFFTARFD 454 Citrobacter freundii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap