2C44


Conserved Protein Domain Family
tnaA_trp_ase

?
TIGR02617: tnaA_trp_ase 
Click on image for an interactive view with Cn3D
tryptophanase, leader peptide-associated
Members of this family belong to the beta-eliminating lyase family (pfam01212) and act as tryptophanase (L-tryptophan indole-lyase). The tryptophanases of this family, as a rule, are found with a tryptophanase leader peptide (TnaC) encoded upstream. Both tryptophanases (4.1.99.1) and tyrosine phenol-lyases (EC 4.1.99.2) are found between trusted and noise cutoffs, but this model captures nearly all tryptophanases for which the leader peptide gene tnaC can be found upstream. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 131666
View PSSM: TIGR02617
Aligned: 4 rows
Threshold Bit Score: 938.587
Threshold Setting Gi: 41018268
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2C44_A         5 KHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALA 84  Escherichia col...
Q7N8C9         2 KRIPEPFRIKMVENIRMTTRAEREKALEEAGYNPFLLPSDAVYIDLLTDSGTGAMSDRQWAGIMMGDEAYAGSRNYYHLC 81  Photorhabdus lu...
WP_000656452  10 KHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALA 89  Escherichia coli
Q9KN05         5 KHLPEPFRIRVIEPVKRTTREYREKAILNAGMNPFLLDSEDVFIDLLTDSGTGAITQEMQAAMFRGDEAYSGSRSYHALA 84  Vibrio cholerae...
2C44_A        85 ESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSkmVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVR 164 Escherichia col...
Q7N8C9        82 DKVNELIGYQYTIPTHQGRGAEQILFPTLIARKKAQGGATHP--VFISNFHFDTTAAHVELNGAKAINVVTSKAFDTTTY 159 Photorhabdus lu...
WP_000656452  90 ESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSkmVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVR 169 Escherichia coli
Q9KN05        85 RAVKDIFGYEYTIPTHQGRGAEQIYIPVLIKKREKEKGLDRSkmVALSNYFFDTTQGHTQINCCVAKNVYTEEAFDTGVK 164 Vibrio cholerae...
2C44_A       165 YDFKGNFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENAYFIKQREAE 244 Escherichia col...
Q7N8C9       160 YDWKGDFDIDELEKTIAEHGADNVVAIITTVTCNSSGGQPISLANMKAVYEIAKQHDIPVVIDSARFCENAWFIKQREKG 239 Photorhabdus lu...
WP_000656452 170 YDFKGNFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENAYFIKQREAE 249 Escherichia coli
Q9KN05       165 ADFKGNFDLEKLEQAILEAGPANVPYIVSTITCNSAGGQPVSIANLKAVYEIAQRYDIPVIMDSARFAENAYFIQQRERD 244 Vibrio cholerae...
2C44_A       245 YKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDsfFDVYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYD 324 Escherichia col...
Q7N8C9       240 YENKSVKQIVKEMYQYGDMLTMSAKKDPLVNIGGLCCFRDD--EDLFNEVRTRCVPMEGFVTYGGLAGRDMEALAIGLEE 317 Photorhabdus lu...
WP_000656452 250 YKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDsfFDVYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYD 329 Escherichia coli
Q9KN05       245 YRNWSIEEITREAYKYADGLAMSAKKDAMVQMGGLLCFKDEsfFDVYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYD 324 Vibrio cholerae...
2C44_A       325 GMNLDWLAYRIAQVQYLVDGLEEIGVVCQQ-AGGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGR 403 Escherichia col...
Q7N8C9       318 GMNEGYLAYRINQVAYLGNRLRDAGIPIQYpTGGHAVFVDAKLLLPHIPGEQFPAHALNNELYLEAGIRSVEIGSLLLGR 397 Photorhabdus lu...
WP_000656452 330 GMNLDWLAYRIAQVQYLVDGLEEIGVVCQQ-AGGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGR 408 Escherichia coli
Q9KN05       325 GMRQDWLAYRINQVEYLVNGLEAIGVICQQ-AGGHAAFVDAGKLLPHIPADQFPAHALACELYKVAGIRAVEIGSLLLGR 403 Vibrio cholerae...
2C44_A       404 DPKTGKQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENASNIKGLTFTYEPKVLRHFTAKLKEV 471 Escherichia coli O157:H7 st...
Q7N8C9       398 DPKTGKQKPSPMELLRLTIPRRVYTNDHMDYVVEAFISLKERIPQIKGLTFTYEPSVLRHFVARLKPI 465 Photorhabdus luminescens su...
WP_000656452 409 DPKTGKQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAANIKGLTFTYEPKVLRHFTAKLKEV 476 Escherichia coli
Q9KN05       404 DPATGKQHPCPAELLRLTIPRATYTQTHMDFIIEAFEKVKANARNVKGLEFTYEPPVLRHFTARLKEK 471 Vibrio cholerae O1 biovar E...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap