Conserved Protein Domain Family

TIGR02615: spoVE 
stage V sporulation protein E
This model represents an exception within the members of the FtsW model TIGR02614. This exception occurs only in endospore-forming genera such as Bacillus, Geobacillus, and Oceanobacillus. Like FtsW, members are found in a peptidoglycan operon context, but in these genera they part of a larger set of paralogs (not just the pair FtsW and RodA) and are required specifically for sporulation, not for viability. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Sporulation and germination]
PSSM-Id: 131664
Aligned: 4 rows
Threshold Bit Score: 484.664
Threshold Setting Gi: 22777153
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P07373   327 TGLIPVTGITLPFLSYGGSSLTLMLMAVGVLLNVSR 362 Bacillus subtilis subsp. subtilis str. 168
AAM24848 326 TSSMPPTGVSLPFISYGGTSTLIMMAGVGILLNISR 361 Caldanaerobacter subterraneus subsp. tengcongensis MB4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap