Conserved Protein Domain Family
spoVE

?
TIGR02615: spoVE 
stage V sporulation protein E
This model represents an exception within the members of the FtsW model TIGR02614. This exception occurs only in endospore-forming genera such as Bacillus, Geobacillus, and Oceanobacillus. Like FtsW, members are found in a peptidoglycan operon context, but in these genera they part of a larger set of paralogs (not just the pair FtsW and RodA) and are required specifically for sporulation, not for viability. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131664
View PSSM: TIGR02615
Aligned: 4 rows
Threshold Bit Score: 484.664
Threshold Setting Gi: 22777153
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P07373     9 DLLLVIITLLLLTIGLIMVYSASAVWADYKFDDSFFFAKRQLLFAGIGVIAMFFIMNVDYWTWRTWSKLLMVICFFLLVL 88  Bacillus subtilis s...
BAC13426  11 DYILLIILSILLMAGIVMVFSSSYIWSEYKFNDAFYYLKRQALFAGAGVAAMIFFMFIPYYTWKKYAKMILFICFILLLL 90  Oceanobacillus ihey...
AAO36172  13 DFLMFCVIMLLVAIGVVMVYSASSYFAFYKHEDSMYFLKRQGLWAILGIFCMFATINIDYHKYKRHTKMLMLITTVLLLV 92  Clostridium tetani E88
AAM24848   8 DYGILLVVMILVAIGVVMVFSASAATAEYMYNDPYYFLKRQLVWAILGFFAMVFTMNVDYLWFKRWAGAFLVISIVLLVL 87  Caldanaerobacter su...
P07373    89 VLIPGVGMVRNGSRSWIGVGAFSIQPSEFMKLAMIAFLAKFLSEKQKNITSFRRGFVPALGIVFSAFLIIMCQPDLGTGT 168 Bacillus subtilis s...
BAC13426  91 VLIPGVGMVRGGAQSWIGIGAFSIQPSEFMKLGLIIFLASLLSEYQKYITSLRKGFLPCLLLIFTAFGLIMLQPDLGTGM 170 Oceanobacillus ihey...
AAO36172  93 VFAF---TEVNGARRWIRLGPASFQPSEIAKYMVVIYLAKSIESKGERIRTFTYGVIPYLLVAGFYAGLVYAEKNLSIAT 169 Clostridium tetani E88
AAM24848  88 VLIPGIGVERYNATRWIGVGNFTVQPSEIAKYALIIYLAKYFDKHPEYAKSLKKGVIPVLGLAGVFFGLIMLQPNFSTAG 167 Caldanaerobacter su...
P07373   169 VMVGTCIVMIFVAGARIAHFVFLGLIGLSGFVGLVLSAPYRIK--RITSYLNPWEDPLGSGFQIIQSLYAVGPGGLFGMG 246 Bacillus subtilis s...
BAC13426 171 VLVLTCMIMLFVAGANLSHFFGLAGIGVIGFIGLIASAPYRIN--RITAFLNPWEDPLGHGFQIIQSLYAIGPGGLMGLG 248 Oceanobacillus ihey...
AAO36172 170 VIMMVTFIILFVAGARFSHLIAIVIPVISAGVAAILLTPFRLG--RLLSFRNPWVDPKGKGYQLIQSFLALGSGGIWGVG 247 Clostridium tetani E88
AAM24848 168 IIFIVSVVMLFVAGAKLSYMGILLG--TGLGVAVLVISSFKYVreRVLTFLNPWQDIQKSGYQIVQSLYALGSGGLFGVG 245 Caldanaerobacter su...
P07373   247 LGQSRQKFFYLPEPQTDFIFAILSEELGFIGGTLILLLFSVLLWRGIRIALGAPDLYGSFVAVGIISMIAIQVMINIGVV 326 Bacillus subtilis s...
BAC13426 249 LGNSLQKYFYLPEPQTDFIFAIIGEELGFIGGAMIIILFFLLLWRGIKIALEAPDLFSRLLAVGISSMLALQAMINISVV 328 Oceanobacillus ihey...
AAO36172 248 LGQSRQKCYYIPEPHNDFIFAVIGEELGLIGCTFIILLFVIFAWRGIVTAVKAKDTFGTLTAIGITSVIGVQALINIAVV 327 Clostridium tetani E88
AAM24848 246 LGNSRQKLMYLPMPHNDFIFSIIGEELGLVGTVTILLMFLYIILRGLRVAAKAPDMFGCLLATGITSLIGIQAFINVAVV 325 Caldanaerobacter su...
P07373   327 TGLIPVTGITLPFLSYGGSSLTLMLMAVGVLLNVSR 362 Bacillus subtilis subsp. subtilis str. 168
BAC13426 329 IGLIPVTGITLPFLSYGGSSLTLTLCSVGILLNISR 364 Oceanobacillus iheyensis HTE831
AAO36172 328 TGSIPVTGVPLPFISYGGSSLVLNMMAMGILLNISR 363 Clostridium tetani E88
AAM24848 326 TSSMPPTGVSLPFISYGGTSTLIMMAGVGILLNISR 361 Caldanaerobacter subterraneus subsp. tengcongensis MB4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap