Conserved Protein Domain Family
TIGR02611

?
TIGR02611: TIGR02611 
TIGR02611 family protein
Members of this family are Actinobacterial putative proteins of about 150 amino acids in length with three apparent transmembrane helix and an unusual motif with consensus sequence PGPGW. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131660
View PSSM: TIGR02611
Aligned: 5 rows
Threshold Bit Score: 129.496
Threshold Setting Gi: 6822236
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE49065       8 VADHLERLNRHHENL-----KHTRYGFIVRPLVLTLGWIVVVVGIITIPFPGPGWLTVFIGIAILSLELHWASNLLAWGV 82  Corynebacterium...
BAC17387      29 VQDRIERLQDAHERS-----KKKKYGFLVRPATLILGWVVMIIGLITIPLPGQGWLTTFIGVGILSLEQNWAKRLLGWGV 103 Corynebacterium...
CAE49586       5 VHNLMNKMQDRHLHM-----KAAWYGPVLSPLLLVAGMCLLIFGIIILPTPAPGWLCIFIALGILSLVHPPTRRLTIWLA 79  Corynebacterium...
CAB70942      25 AERALGSRAPEFVKA------RRALHLSWQVGVFVVGLAVVVAGIIMLPLPGPGWVVIFGGMAIWATEFVWAQLVLRWTK 98  Streptomyces co...
WP_011728698   3 VKEKLSEYRDQWVHQrerlrKRPLANFVYRSVIGVVGTVVLAVGVVAIPYPGPGWAIVFLGLAILATEFRFAEVALRFIR 82  Mycobacterium s...
CAE49065      83 RLYDRFFSWYHVQSTRMRYSLIAATIVACWIVGGGIAIVMWKCGML 128 Corynebacterium diphtheriae
BAC17387     104 HQYDRFFAWYATKSFRFRMLTMAVLLVLIWIVFAVTFWAMWIYGTL 149 Corynebacterium efficiens YS-314
CAE49586      80 SKLDIFFAWYGQRHPAVRTSLVGLLILFMVLVMGGTYLFIAPAHWP 125 Corynebacterium diphtheriae
CAB70942      99 RKVTEAAQRALDPRVRRRNIILTSIGVVIIAVLAGIYLWKFGLEMP 144 Streptomyces coelicolor A3(2)
WP_011728698  83 RRYDEVMAWFARQHIAVKALSAGFTAAVVLATLWGLGALYWAGGLV 128 Mycobacterium smegmatis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap