Conserved Protein Domain Family
PHA_gran_rgn

?
TIGR02610: PHA_gran_rgn 
putative polyhydroxyalkanoic acid system protein
All members of this family are encoded by genes polyhydroxyalkanoic acid (PHA) biosynthesis and utilization genes, including proteins at found at the surface of PHA granules. Examples so far are found in the Pseudomonales, Xanthomonadales, and Vibrionales, all of which belong to the Gammaproteobacteria.
Statistics
?
PSSM-Id: 131659
View PSSM: TIGR02610
Aligned: 3 rows
Threshold Bit Score: 138.914
Threshold Setting Gi: 499371225
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAN70576      21 MTQISVERKHSLGRDAARAKAEALVDKLSREYDLKATWNGDRVDVARSGANGSVHIGDDSIRVELKLGMMLSMMSGTIKG 100 Pseudomonas put...
AAM40881       1 MSSIDIRHDHSRTPAQARAAIEDAARKLTDRYGIASHWEGDTLRIARAGVDGAINLLPQQVQVTAELGFLLSAMQPMVES 80  Xanthomonas cam...
WP_011058803   1 MARISVERAHGLGKQAAREKADKLAQKLADQYGLEPQWAGDTLNLKRSGVKGAVHVGEESIRIDVELGMLMSAMSGTIKS 80  fluorescent pse...
AAN70576     101 EIERALDKALA 111 Pseudomonas putida KT2440
AAM40881      81 EIRRLLAEKLA 91  Xanthomonas campestris pv. campestris str. ATCC 33913
WP_011058803  81 EIEKALDKALV 91  fluorescent pseudomonads
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap