Conserved Protein Domain Family
8TM_EpsH

?
TIGR02602: 8TM_EpsH 
exosortase
This family is designated exosortase, and it is the predicted protein-sorting transpeptidase for the PEP-CTERM protein-sorting signal of many biofilm-producing Gram-negative bacteria. This system is analogous to the sortase/LPXTG system found mostly in Gram-positive bacteria. Members of this family are integral membrane proteins with eight predicted transmembrane helices in common, and with a triad of invariant residues that matches the catalytic triad of sortases. Some members of this family have long trailing sequences past the region described by this model, which in other species is a separate protein EpsI. This model does not include the region of the first predicted transmembrane region. The only partially characterized member is EpsH of Methylobacillus sp. 12S, part of a locus associated with biosynthesis of the exopolysaccharide methanolan but itself not involved in polysaccharide biosynthesis. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 131651
View PSSM: TIGR02602
Aligned: 7 rows
Threshold Bit Score: 250.375
Threshold Setting Gi: 46447734
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAS94400      33 VGDWNFDPNYSHGFLVPCLALWFAWMRWPELREAEVRPSAWGLGLLAAGLCLLVLGSVLIELFTSRASLVVLMMGTVLFL 112 Desulfovibrio v...
AAR35355      45 VQAWSGSEDYSHGFLIAPLSAYIIWQKREIFSRPGSAGSSGGLALVVLSLAAYLFAHVAGITTLAALSMVAFLWGTVVYL 124 Geobacter sulfu...
CAI08535      52 ASIWWRSDTFAHGLVVLPIFAWLVWRKREALSPLALVPAPVMLIALVPAGIAWLVAELISASAPAHFSLALILVFSVIAV 131 Aromatoleum aro...
CAD85708      46 VAIWNRSDTYAHGYLILPFSVYMIWKKRAMLSTIQYRPDYMPLSVLVGLGAGWLLASAASVVVVEQYALVAMIPVIVWAL 125 Nitrosomonas eu...
WP_011118855  73 FSRMWRLDHYQYFPFAIGAVVWLAWSRSDRYFYAPSRISS--LLLISVGVLAMIGSWSLRSPWMMSIAFVCYAAASLGVM 150 Rhodopirellula ...
WP_010994673  42 KTISTEHEYFSHGIIGIPFAAYLSWGNRKKWQRLPNKTHPLGATLLVIGAVFYLTG----VTEWVNLSLPTILAGLCLWF 117 Nostoc sp. PCC ...
WP_011045709  40 WRYSFDDGTYSHAYLIPLIVAYLFYVIN-NNGELKYRETISLPASVLLIISAYILFVTSTAQISLLYWLTILLLFCSSII 118 Colwellia psych...
AAS94400     113 YGRDAFRILLFPLAYLLFMIPL--PYtVYDALALPLKGLVSFAATGGIKLLGLPVLREGNVIIFPNITLEVVDACSGLRS 190 Desulfovibrio v...
AAR35355     125 FGFRVYCQALFPLTLLLFMIPI--PAqIYAALTIPLQLIVSKLAVGLALATGIPVYREGNVIHLAQGTFEVVQACSGLRS 202 Geobacter sulfu...
CAI08535     132 IGWRLARVLAFPLLFLFFGVPA--G----EFLLPVLMKYTADFTVLALRATGVPVYQEGLHFVVPNGRWSVVEACSGLRY 205 Aromatoleum aro...
CAD85708     126 LGLRAFSAILFPLAYLLFAVPF--G----EIFIPPLIDFTADFTVGALQATGIPVYREGSFFSIPSGNWSVVEACSGVRY 199 Nitrosomonas eu...
WP_011118855 151 RGPDDKSLLILALPLLLLIRLP--LG-YDQLLVIQLQHLTTMMSSLLLDVLSIPHAVTRNVIELPSRELFVAEACSGIQS 227 Rhodopirellula ...
WP_010994673 118 KGFPGLRLQGFPLLLLFLATPTaiPY-LIAPYTFPLQSFIAGTAGFILNQFGMDAVVDGINIYVSGRIVEVAPYCAGLKM 196 Nostoc sp. PCC ...
WP_011045709 119 FVFNANIKIAAAASYFIFLLPV--WG----ILTIPLQNLSVFAAQTLMGFTTIPVFVEEQFVHIPSGVFEIAGGCSGLRY 192 Colwellia psych...
AAS94400     191 IMSLAALGTAFAFL--FLPAGWRRWTLVLATVPIAVATNTLRVFVTGVLSWYIGKDAARGFFHDFEGLVVFAVAMALTAA 268 Desulfovibrio v...
AAR35355     203 IMALLTIGAVLGYF--SLTSNLLRAILFATGIPIAVAVNILRVFVLIVAFHYLNIDLAKGTAHTVLGLALFVVSFGLFLL 280 Geobacter sulfu...
CAI08535     206 LAASLMIGALYAYL--NYTSLKRRLLFMLVALIVPIVANWIRAYITVMIGYQFGSEFVQGFIHIVYGWVFFGVVIFLMFM 283 Aromatoleum aro...
CAD85708     200 LIASVTLGTLYAYL--TYHSISRRLIFIAFSIVVPIVANGVRAYLIVMTGHLSDMQLAVGVDHLVYGWIFFGLVMLLLFW 277 Nitrosomonas eu...
WP_011118855 228 VFTMAFLSTLIVAI--NRRKLWLAPFYLIVALILAAGGNVLRVSMVAVADQWMSLDLASGWAHDILGYTTLAISAFFLWS 305 Rhodopirellula ...
WP_010994673 197 LFTTIYVCLMLLYWtdNLSSRRTTVWFLSAAVLISVIANIIRNTILSFF-HGTGQDAAFKWLHDSWGGDLYSALMLLSLI 275 Nostoc sp. PCC ...
WP_011045709 193 LLTSLAISTLFSFL--YFRTIKNTAIFISVAILGALLTNWLRISALIIIGHQTEMTSDLMTDHNMFGWYIYIPFMFLLFK 270 Colwellia psych...
AAS94400     269 LGFVLA 274 Desulfovibrio vulgaris str. Hildenborough
AAR35355     281 IRKGLS 286 Geobacter sulfurreducens PCA
CAI08535     284 IGARWK 289 Aromatoleum aromaticum EbN1
CAD85708     278 IGSFWR 283 Nitrosomonas europaea ATCC 19718
WP_011118855 306 FDGMIM 311 Rhodopirellula baltica
WP_010994673 276 PILNRM 281 Nostoc sp. PCC 7120
WP_011045709 271 FGGYLA 276 Colwellia psychrerythraea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap