Conserved Protein Domain Family
cas_Cas5h

?
TIGR02592: cas_Cas5h 
CRISPR-associated protein Cas5, subtype I-B/HMARI
This is a CRISPR-associated protein unique to the hmari subtype of cas genes and CRISPR repeat, which is the only subtype present in Haloarcula marismortui ATCC 43049. The hmari type, though uncommon, is also found in the Aquificae, Thermotogae, Firmicutes, and Dictyoglomi.
Statistics
?
PSSM-Id: 131641
View PSSM: TIGR02592
Aligned: 4 rows
Threshold Bit Score: 296.404
Threshold Setting Gi: 495469731
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAO36023       2 DALKFSLSGRTAFFKKPDVnSFFYFTYGNVHKVALLGILGAICGYGgynsqclnKEQIYPEFYekLKDINIGVVPKNEKG 81  Clostridium tet...
AAM30258       2 DCLVFRAKSGYAKFRKPYT-TTSALTFLCIHPPAVKGLIGAVLGID--------KTEIYRNTL--DLKIGIQVLSPVRKD 70  Methanosarcina ...
vng:pNG4050   20 RCLSLTVRGPWGHFRRVEG-NVVKQTYRVMPRTTVAGLIAAVLGIE--------RDGYYDLFApgRSAIAIEPVRGLRTL 90  Haloarcula mari...
WP_008194420   5 KVLVFDVSAPYALFRRPYT-TTSSYTLPFPPRTTLLGLVGCVLGYS--------TPERLDS-----AKVAVQIKNPLKFL 70  Thermotoga sp. EMP
AAO36023      82 YIDKKIQVFNNSvgy-----------asKELGGnLIVKEQWLENPKWAIYILMDE-NVPKDLKDRLLNFKFKYIPYLGKN 149 Clostridium tet...
AAM30258      71 MQVLKLVSMKAE----------------KDLFN-FPVNAEFLRDPEYRIFVSWLP-DKLDELEDRLQNQMPIFTPYLGVS 132 Methanosarcina ...
vng:pNG4050   91 NMPVNALSTAADnlkslnsrgklsvklpDPMDLrQQHNYEVLVDPAYRIDVALADsETYRELRQTLEAGRSHYVPSLGLS 170 Haloarcula mari...
WP_008194420  71 RTGTNFVETKKD----------------KKASKrTRISLQLLKNPAYRVFFSWED-EDFERLKNLLEHSETIFTPYLGVA 133 Thermotoga sp. EMP
AAO36023     150 DHMANITDVEYLENIEkLDNT-NKLDSIFIKDKyeIQKESKNFNDLKNIIKKSSSKIQEFKYEEMLPISLEETTNKYNLE 228 Clostridium tet...
AAM30258     133 EYIAKLDYEKRVNAEL-LTKS-SSIDSLVPSRF--IDLQHSDYHIFTDNIPVSNNEKREYISYEKILFAFREDDTCKKEI 208 Methanosarcina ...
vng:pNG4050  171 EHLANISFHGEFTIEEgPDDTvVSVDSTLPNAVddVVLDSDTRCGIEESPAFMTTDAGGRTTTAFTTYAYNPDAEPLRVR 250 Haloarcula mari...
WP_008194420 134 SFIARLNYVGKYEATR-VADFpCEVHTVVPNTV--KLLPEPSHYLIFERVTRKMDKER--NMLESAVYIFKRDLSPVKVE 208 Thermotoga sp. EMP
AAO36023     229 TFIYTNSnlkplADTKTYKCGDKNIFFF 256 Clostridium tetani E88
AAM30258     209 ACSLMGN-----LKRDVYKVDENIVFFF 231 Methanosarcina mazei Go1
vng:pNG4050  251 NMQ-------------PSRVDGRTVVFV 265 Haloarcula marismortui ATCC 43049
WP_008194420 209 GG-------------EVWRVGEQNIVWM 223 Thermotoga sp. EMP
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap