Conserved Protein Domain Family
TIGR02588

?
TIGR02588: TIGR02588 
TIGR02588 family protein
The function of this protein is unknown. It is always found as part of a two-gene operon with TIGR02587, a protein that appears to span the membrane seven times. It is found in Nostoc sp. PCC 7120, Agrobacterium tumefaciens, Sinorhizobium meliloti, and Gloeobacter violaceus, so far, all of which are bacterial. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131637
View PSSM: TIGR02588
Aligned: 4 rows
Threshold Bit Score: 185.425
Threshold Setting Gi: 499269761
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC90092       7 TLAEQVSFGLCVAILAGLVGLVIYDWIASDGKAAVLVAAPAGAVRsAAGQFYVPFAVENQGGQTAEAVRVEAELRSAEGS 86  Gloeobacter vio...
WP_010973591  16 HWIEWVTGTISTLLVAAMFGWIAYDIYRYSPEEARFEIAVTGVEG-QTGQYRVKFAIHNLSMTTAAQVNVRGDLEQNGAS 94  Agrobacterium f...
WP_010998782  11 SLAEWVTFGIALFILGIIMSLVAYIWLHEENKPPVLSVTKKEIMReVNGQFYIPFEIVNTGGETAESVQIIAELQIAGKV 90  Nostoc sp. PCC ...
WP_010967154  28 SIAEWIVAGVSCLALLAVLGYLILDGLSGRNGAADIIVLPAEVTAmNDG-YVVEFAANNRAGKSVAAVEIKGELRGGEEV 106 Sinorhizobium m...
BAC90092      87 REVAEQEIDFLAGGETETGVFIFERDPRAGQLRLRVSGYKVP 128 Gloeobacter violaceus PCC 7421
WP_010973591  95 PENADVTFDYVASESKDNGTLFFRSDPRNGTLTLTVAGYTEP 136 Agrobacterium fabrum
WP_010998782  91 VETGEQQIDFLSDGEKEEGTFIFSQNPRQGQLIVRVASYKLP 132 Nostoc sp. PCC 7120
WP_010967154 107 VEESGVTIDYIPQKSERKGALIFRSDPEGYELRIFASGYSEP 148 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap