Conserved Protein Domain Family
TIGR02587

?
TIGR02587: TIGR02587 
putative integral membrane protein TIGR02587
Members of this family are found in Nostoc sp. PCC 7120, Agrobacterium tumefaciens, Sinorhizobium meliloti, and Gloeobacter violaceus in a conserved two-gene neighborhood. This family, as defined, includes some members of COG4711 but is narrower and strictly bacterial. Members appear to span the membrane seven times. [Cell envelope, Other]
Statistics
?
PSSM-Id: 131636
View PSSM: TIGR02587
Aligned: 3 rows
Threshold Bit Score: 361.833
Threshold Setting Gi: 499269762
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010998783  11 KREINDIVRGTCGGFLFGIPLIYTMEVWWIGSLAKPRLIVIAIALMFMVVFLLNYTEGFRKRKnnwRVDEAVIDTVEAMA 90  Nostoc sp. PCC ...
WP_006313903  16 RQFLTGLARGTAGALLFALPMLMTMEMWFLGLYVNPWRLLLLCILNLPLLFLLARRIGFEKTD---SWRQAWRDTLTAYG 92  Agrobacterium s...
WP_010967155  13 REFWIGLGRAFAGALIFAVPVLMTMEAWALGFHLHPLRLALLLVATVPTLVLLHKYGGFRKSV---GLRDRIADAFVALL 89  Sinorhizobium m...
WP_010998783  91 IGFVCSAFMLWLLQEITPETSLKESLGKIVFEGVPFTLGVALANQFLGDTNQNNSpssnhqengLSKHKQNSLYGTLADL 170 Nostoc sp. PCC ...
WP_006313903  93 LGIMVSAAVLLLFGILNDQLTASNIVAKVALQSVPASIGALLGRSQLGQRSDAED---------EEEGEYSGETGYLHEL 163 Agrobacterium s...
WP_010967155  90 VAAIAASAILFSFGIVDADMPLREIVGKVAVQIVPGSLGASLARAQLGPSP--------------LEGDAVPEPAYAGEL 155 Sinorhizobium m...
WP_010998783 171 GATLIGAIVIAFNIAPTDEVPMLAAAISPPWIFILIAASLVISYAIVFQAGFSDQKKRRQQKGIFQRPLSETTISYLVSL 250 Nostoc sp. PCC ...
WP_006313903 164 FMMMVGALFLSLNVAPTEEMILIAYKVTPYHILALCLLSIAIMHGFVYALHFRGSHRLHEGQQWWQAFIRFTLPGYVVAI 243 Agrobacterium s...
WP_010967155 156 FLMVVGALFLSVNIAPTEEVVLIAYKMNPWHEIALALGTLGLMHVFVYELEFRGTHNPEPGAGFVNIFFRYTIVGYCLVM 235 Sinorhizobium m...
WP_010998783 251 LASALMLLFFQKVTFADpWRMWLEHTLVLGLPATIGGAAGRLAI 294 Nostoc sp. PCC 7120
WP_006313903 244 AISIYTLWTFERLDHTS-LSQIMNAAVILGVPASIGAASARLIL 286 Agrobacterium sp. ATCC 31749
WP_010967155 236 LVNFYILWTFGRTDGVG-FSETLSAVVVLSFPGALGAAVARLIL 278 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap