Conserved Protein Domain Family
LcrG_PcrG

?
TIGR02573: LcrG_PcrG 
type III secretion protein LcrG
This protein is found in type III secretion operons, along with LcrR, H and V. Also known as PcrG in Pseudomonas, the protein is believed to make a 1:1 complex with PcrV (LcrV). Mutants of LcrG cause premature secretion of effector proteins into the medium .
Statistics
?
PSSM-Id: 131624
View PSSM: TIGR02573
Aligned: 4 rows
Threshold Bit Score: 103.69
Threshold Setting Gi: 489211543
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC59923      2 KQPFTQAIENAELAIRNADERNDIFSELLEGLGVGPVAGEVLLGGLNAspKLMQHAEQELIEEVQRRRQQQHQlQGVQGK 81  Vibrio parahaemo...
P19394        6 FDEYDKTLKQAELAIADSDHRAKLLQEMCADIGLTPEAVMKIFAGRSA--EEIKPAERELLDEIKRQRERQPQ-HPYDGK 82  Yersinia pestis
CAE16131      3 EEPNAKVLQAAEAAIKDSDHRLQLLQEMWQSLGINPNVGTELFGHTDV--TLVQNAEQELLTEVNRLRSNQPP-SLEEGK 79  Photorhabdus lum...
WP_003120339  9 EDTLRATVQAAELAIRDSEERGRLLAEMWQGLGLAADAGELLFQAPER--ELARAAEEELLAELRRMRSSQPT-QGEQGT 85  Pseudomonas aeru...
BAC59923     82 RRKRPTMMRGMVI 94  Vibrio parahaemolyticus RIMD 2210633
P19394       83 RPRKPTMMRGQII 95  Yersinia pestis
CAE16131     80 RLRRPPRMRGIIV 92  Photorhabdus luminescens subsp. laumondii TTO1
WP_003120339 86 RPRRPTPMRGLLI 98  Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap