Conserved Protein Domain Family
LcrR

?
TIGR02572: LcrR 
type III secretion system regulator LcrR
This protein is found in type III secretion operons and has been characterized in Yersinia as a regulator of the Low-Calcium Respone (LCR). [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 131623
View PSSM: TIGR02572
Aligned: 4 rows
Threshold Bit Score: 234.705
Threshold Setting Gi: 28806652
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P19393         2 MADPLIPWLTEHGLVCHPHTLSGTPISLGSAFQLAGLKLAWRVEIEqrRVWIVLIQRVEQRRGLKNPFAALYMLANAARA 81  Yersinia pestis
CAE16132       2 NRDPLTPWFEEQGYSVQPHCMGNSPIPLGWRVWYEGCEIAWRYDAP--RVWIVMLRRTRQRRGLANPFAPLYLLATATMA 79  Photorhabdus lu...
BAC59924       1 MNAALVQSFEQTGIEVTPYFWQKSAIQLGYRMEVDGMELVFRVEEG--EIIIVLLKRVSPNLGLSNPFSCLFLLAEHAIP 78  Vibrio parahaem...
WP_003100791   2 SADPLIPWFLARGLAVRPHCLRDTSIALGWQVLAHGCELAWRCDGE--RVWIVMLRRRQARSGLANPFAALYLLAEATLD 79  Pseudomonas
P19393        82 VLGPDYYLYGNVDVLAGSSLSTQRLAHFYRRWTGAKELSTG-WFSLKVSQVITLSNMKKRQN 142 Yersinia pestis
CAE16132      80 MLGPGSRLYGQVNTLVDSPLNDERLARFYHRWTGANEVVPG-WFELEASCVISLHQMRKQQK 140 Photorhabdus luminescens subsp. l...
BAC59924      79 LFPSDWVIRGNVDVLRGSNMSSQRLAQFYLRACGASHDQQAdWYFLRLADYRPLKKRKM--- 137 Vibrio parahaemolyticus RIMD 2210633
WP_003100791  80 TLGPRQRLYGKVLALAGSPLPGERMARFYRRWTGAAEPADG-WFELEAGRVVTQRSLRKRQK 140 Pseudomonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap